You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
RASA2
Ras GTPase-activating protein 2

Protein Summary
Description
Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4). The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000286364
  • ENSP00000286364
  • ENSG00000155903

Symbol
  • GAP1M
  • RASGAP
  • GAP1M
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
cell type or tissue
0.78
histone modification site profile
0.74
transcription factor perturbation
0.74
transcription factor binding site profile
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.49   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.49   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (28)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
FLT3 Signaling
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
FLT3 Signaling
Immune System
Gene Ontology Terms (8)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (58)
1 – 10 of 58
HDGFL2
Tbio
Family: Epigenetic
Novelty: 0.12835229
p_int: 0.998749292
p_ni: 0.000009514
p_wrong: 0.001241194
Data Source: BioPlex
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.972
Data Source: STRINGDB
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
Score: 0.955
Data Source: STRINGDB
KRAS
Tchem
Family: Enzyme
Novelty: 0.00018907
Score: 0.95
Data Source: STRINGDB
RRAS
Tbio
Family: Enzyme
Novelty: 0.00229703
Score: 0.948
Data Source: STRINGDB
SPRED1
Tbio
Novelty: 0.0131778
Score: 0.937
Data Source: STRINGDB
RASA1
Tbio
Family: Enzyme
Novelty: 0.00312451
Score: 0.933
Data Source: STRINGDB
NF1
Tbio
Novelty: 0.00021961
Score: 0.928
Data Source: STRINGDB
SYNGAP1
Tbio
Family: Enzyme
Novelty: 0.00957978
Score: 0.927
Data Source: STRINGDB
RASAL2
Tbio
Family: Enzyme
Novelty: 0.02657473
Score: 0.925
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.49

PubMed score by year
PubTator Score  14.86

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMRDCFCTINLDQ
1-70
EEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGKVAIKKEDLCNHSGKETWFSL
70-140
QPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKT
140-210
KVKKKTSNPQFNEIFYFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLR
210-280
TDSSHQAWYLLQPRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYIL
280-350
SEICRDKNDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
350-420
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCDIFYSLRQMAT
420-490
QRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLISKTIQTLGSWGSLSKSKSS
490-560
FKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRW
560-630
FCLTSRELTYHKQPGSKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDV
630-700
LCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSL
700-770
LKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS
770-840
KENPIVGKAS
840-850
MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMRDCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGKVAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILSEICRDKNDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKVTLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCDIFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS