You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STK38
Serine/threonine-protein kinase 38

Protein Classes
Protein Summary
Description
Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2. This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229812
  • ENSP00000229812
  • ENSG00000112079

Symbol
  • NDR1
  • NDR
  • NDR1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
protein domain
0.92
interacting protein
0.9
disease perturbation
0.87
PubMedID
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.12   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 412   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.12   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 412   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (13)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Protein-Protein Interactions (81)
1 – 10 of 81
MOB2
Tbio
Family: Enzyme
Novelty: 0.03351955
p_int: 1
Score: 0.912
Data Source: BioPlex,STRINGDB
MARVELD2
Tbio
Novelty: 0.01661397
p_int: 0.999999467
p_ni: 5.25e-7
p_wrong: 8e-9
Score: 0.269
Data Source: BioPlex,STRINGDB
MOB1B
Tbio
Family: Enzyme
Novelty: 0.17103193
p_int: 0.999999446
p_ni: 5.52e-7
p_wrong: 1e-9
Score: 0.895
Data Source: BioPlex,STRINGDB
LAMTOR5
Tbio
Novelty: 0.00523099
p_int: 0.999942954
p_ni: 0.000057045
p_wrong: 1e-9
Data Source: BioPlex
S100B
Tchem
Novelty: 0.00038202
Score: 0.944
Data Source: STRINGDB
MOB1A
Tbio
Family: Enzyme
Novelty: 0.0429382
Score: 0.924
Data Source: STRINGDB
MOB3A
Tdark
Family: Enzyme
Novelty: 2.66666667
Score: 0.767
Data Source: STRINGDB
FRY
Tdark
Novelty: 0.00065636
Score: 0.761
Data Source: STRINGDB
FRYL
Tdark
Novelty: 0.13475936
Score: 0.761
Data Source: STRINGDB
DIS3L2
Tbio
Family: Enzyme
Novelty: 0.0352418
Score: 0.709
Data Source: STRINGDB
Publication Statistics
PubMed Score  26.12

PubMed score by year
PubTator Score  103.58

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA
1-70
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI
70-140
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH
140-210
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF
210-280
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS
280-350
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
350-420
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
420-465
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK