You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
P2RY6
P2Y purinoceptor 6

Protein Summary
Description
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor, which is a G-protein coupled receptor, is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. It is proposed that this receptor mediates inflammatory responses. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Mar 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000349767
  • ENSP00000309771
  • ENSG00000171631
  • ENST00000393590
  • ENSP00000377215
  • ENST00000393591
  • ENSP00000377216
  • ENST00000393592
  • ENSP00000377217
  • ENST00000538328
  • ENSP00000442990
  • ENST00000540124
  • ENSP00000442551
  • ENST00000540342
  • ENSP00000443427
  • ENST00000542092
  • ENSP00000445652
  • ENST00000618468
  • ENSP00000480966

Symbol
  • P2Y6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.75
tissue sample
0.75
small molecule perturbation
0.67
transcription factor
0.67
ligand (chemical)
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 108.23   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 237   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 108.23   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 237   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 28
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
suramin
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Nucleotide-like (purinergic) receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Nucleotide-like (purinergic) receptors
Protein-Protein Interactions (192)
1 – 10 of 192
CCKAR
Tclin
Family: GPCR
Novelty: 0.00159237
Score: 0.95
Data Source: STRINGDB
P2RY11
Tchem
Family: GPCR
Novelty: 0.02104546
Score: 0.929
Data Source: STRINGDB
LTB4R
Tchem
Family: GPCR
Novelty: 0.00174481
Score: 0.923
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.917
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.917
Data Source: STRINGDB
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
Score: 0.916
Data Source: STRINGDB
GRK5
Tchem
Family: Kinase
Novelty: 0.01219315
Score: 0.915
Data Source: STRINGDB
P2RY2
Tclin
Family: GPCR
Novelty: 0.00178586
Score: 0.915
Data Source: STRINGDB
P2RY10
Tchem
Family: GPCR
Novelty: 0.30443923
Score: 0.915
Data Source: STRINGDB
P2RY1
Tchem
Family: GPCR
Novelty: 0.00263409
Score: 0.915
Data Source: STRINGDB
Publication Statistics
PubMed Score  108.23

PubMed score by year
PubTator Score  181.02

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLAL
1-70
ADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGG
70-140
RRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLA
140-210
CYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFA
210-280
AAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR
280-328
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR