You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACOX1
Peroxisomal acyl-coenzyme A oxidase 1

Protein Summary
Description
Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. Isoform 1 shows highest activity against medium-chain fatty acyl-CoAs and activity decreases with increasing chain length. Isoform 2 is active against a much broader range of substrates and shows activity towards very long-chain acyl-CoAs. Isoform 2 is twice as active as isoform 1 against 16-hydroxy-palmitoyl-CoA and is 25% more active against 1,16-hexadecanodioyl-CoA. The protein encoded by this gene is the first enzyme of the fatty acid beta-oxidation pathway, which catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It donates electrons directly to molecular oxygen, thereby producing hydrogen peroxide. Defects in this gene result in pseudoneonatal adrenoleukodystrophy, a disease that is characterized by accumulation of very long chain fatty acids. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293217
  • ENSP00000293217
  • ENSG00000161533
  • ENST00000301608
  • ENSP00000301608

Symbol
  • ACOX
  • ACOX
  • SCOX
  • PALMCOX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.96
transcription factor perturbation
0.94
protein domain
0.92
molecular function
0.91
interacting protein
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 150.42   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 352   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 150.42   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 352   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (28)
Beta-oxidation of very long chain fatty acids (R-HSA-390247)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta-oxidation of very long chain fatty acids
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PPARA activates gene expression
Name
Explore in Pharos
Explore in Source
Beta-oxidation of very long chain fatty acids
Fatty acid metabolism
Metabolism
Metabolism of lipids
PPARA activates gene expression
Gene Ontology Terms (31)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (239)
1 – 10 of 239
UBA5
Tbio
Novelty: 0.05833603
p_int: 0.999999059
p_ni: 9.41e-7
Score: 0.152
Data Source: BioPlex,STRINGDB
RIDA
Tbio
Family: Enzyme
Novelty: 0.01567183
p_int: 0.99932713
p_ni: 0.000672869
Score: 0.206
Data Source: BioPlex,STRINGDB
UBE2D2
Tbio
Novelty: 0.00827182
p_int: 0.999259516
p_ni: 0.000740484
Score: 0.917
Data Source: BioPlex,STRINGDB
LAD1
Tbio
Novelty: 0.03138033
p_int: 0.999008941
p_ni: 0.000991059
Data Source: BioPlex
ACBD7
Tdark
Novelty: 1.13055182
p_int: 0.998928387
p_ni: 0.001071613
Score: 0.292
Data Source: BioPlex,STRINGDB
ARL2
Tbio
Family: Enzyme
Novelty: 0.02796176
p_int: 0.99867174
p_ni: 0.00132826
Data Source: BioPlex
SLC9A3R2
Tbio
Family: Transporter
Novelty: 0.01296563
p_int: 0.998573567
p_ni: 0.001426433
Data Source: BioPlex
DUSP14
Tbio
Family: Enzyme
Novelty: 0.06597118
p_int: 0.996056707
p_ni: 0.003943293
Data Source: BioPlex
KHDRBS2
Tbio
Novelty: 0.04072144
p_int: 0.99594209
p_ni: 0.00405791
Score: 0.176
Data Source: BioPlex,STRINGDB
TXNDC16
Tdark
Novelty: 0.28571429
p_int: 0.974756226
p_ni: 0.025243774
Data Source: BioPlex
Publication Statistics
PubMed Score  150.42

PubMed score by year
PubTator Score  267.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIM
1-70
VKKMREFGIADPDEIMWFKKLHLVNFVEPVGLNYSMFIPTLLNQGTTAQKEKWLLSSKGLQIIGTYAQTE
70-140
MGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIR
140-210
EIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVF
210-280
VRSFLVGEAARALSKACTIAIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKE
280-350
TYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTF
350-420
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLR
420-490
AARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCL
490-560
LYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYE
560-630
NLFEWAKNSPLNKAEVHESYKHLKSLQSKL
630-660
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKKLHLVNFVEPVGLNYSMFIPTLLNQGTTAQKEKWLLSSKGLQIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL