You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WDR43
WD repeat-containing protein 43

Protein Summary
Description
Ribosome biogenesis factor. Involved in nucleolar processing of pre-18S ribosomal RNA. Required for optimal pre-ribosomal RNA transcription by RNA polymerase I.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000407426
  • ENSP00000384302
  • ENSG00000163811

Symbol
  • KIAA0007
  • UTP5
  • UTP5
  • NET12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
disease perturbation
0.9
transcription factor binding site profile
0.78
tissue sample
0.64
transcription factor
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.57   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 74   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.57   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 74   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Major pathway of rRNA processing in the nucleolus and cytosol
Reactome
Metabolism of RNA
Reactome
rRNA modification in the nucleus and cytosol
Reactome
rRNA processing
Reactome
rRNA processing in the nucleus and cytosol
Name
Explore in Pharos
Explore in Source
Major pathway of rRNA processing in the nucleolus and cytosol
Metabolism of RNA
rRNA modification in the nucleus and cytosol
rRNA processing
rRNA processing in the nucleus and cytosol
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (347)
1 – 10 of 347
UTP4
Tbio
Novelty: 0.02124144
p_int: 0.99999987
p_ni: 1.26e-7
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
NOL7
Tbio
Novelty: 0.25263158
p_int: 0.99995558
p_ni: 0.000044114
p_wrong: 3.07e-7
Score: 0.843
Data Source: BioPlex,STRINGDB
FBL
Tbio
Family: Enzyme
Novelty: 0.00044932
p_int: 0.999908856
p_ni: 0.000091142
p_wrong: 2e-9
Score: 0.998
Data Source: BioPlex,STRINGDB
MPHOSPH6
Tbio
Family: Enzyme
Novelty: 0.33010883
p_int: 0.999494266
p_ni: 0.000490434
p_wrong: 0.0000153
Score: 0.908
Data Source: BioPlex,STRINGDB
C1D
Tbio
Novelty: 0.01491795
p_int: 0.999421018
p_ni: 0.000578981
Score: 0.92
Data Source: BioPlex,STRINGDB
RBM4
Tbio
Novelty: 0.0098621
p_int: 0.997174228
p_ni: 0.002825768
p_wrong: 4e-9
Score: 0.209
Data Source: BioPlex,STRINGDB
FGF12
Tbio
Novelty: 0.03928258
p_int: 0.991408329
p_ni: 0.00832881
p_wrong: 0.000262861
Data Source: BioPlex
WDR46
Tdark
Novelty: 0.36421448
p_int: 0.987853999
p_ni: 0.005367451
p_wrong: 0.00677855
Score: 0.999
Data Source: BioPlex,STRINGDB
MPHOSPH10
Tbio
Novelty: 0.05857762
Score: 0.999
Data Source: STRINGDB
HEATR1
Tbio
Novelty: 0.13333333
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.57

PubMed score by year
PubTator Score  7.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPA
1-70
RLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGC
70-140
LYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATP
140-210
VSSLMFTTIRPPNESQPFDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSEN
210-280
KEEPVKLAVVCRDGQVHLFEHILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLV
280-350
YGSWFQPTIERVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP
350-420
QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNKVLQTRNVNLI
420-490
KKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLSTLPDLVPQLGTLYQLMESRVK
490-560
TFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYEEESSEEESDDEIADKDSEDNWDEDEEESES
560-630
EKDEDVEEEDEDAEGKDEENGEDRDTASEKELNGDSDLDPENESEEE
630-677
MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGCLYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATPVSSLMFTTIRPPNESQPFDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFEHILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLVYGSWFQPTIERVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPPQTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNKVLQTRNVNLIKKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLSTLPDLVPQLGTLYQLMESRVKTFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYEEESSEEESDDEIADKDSEDNWDEDEEESESEKDEDVEEEDEDAEGKDEENGEDRDTASEKELNGDSDLDPENESEEE