You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KARS
Lysine--tRNA ligase

Protein Summary
Description
Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (PubMed:9278442, PubMed:18029264, PubMed:18272479). When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages (PubMed:15851690). Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity (PubMed:5338216, PubMed:14975237, PubMed:19524539, PubMed:23159739). (Microbial infection) Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation. Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302445
  • ENSP00000303043
  • ENSG00000065427
  • ENST00000319410
  • ENSP00000325448

Symbol
  • KIAA0070
  • KRS
  • KARS1
  • KARS2
  • CMTRIB
  • DFNB89
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
interacting protein
1
kinase perturbation
1
molecular function
0.98
protein domain
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 304.17   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 304.17   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 45
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Cytosolic tRNA aminoacylation (R-HSA-379716)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic tRNA aminoacylation
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Metabolism of proteins
Reactome
Mitochondrial tRNA aminoacylation
Name
Explore in Pharos
Explore in Source
Cytosolic tRNA aminoacylation
Metabolism
Metabolism of amino acids and derivatives
Metabolism of proteins
Mitochondrial tRNA aminoacylation
Gene Ontology Terms (33)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (303)
1 – 10 of 303
RARS
Tchem
Family: Enzyme
Novelty: 0.00081224
p_int: 0.999994549
p_ni: 0.000005451
Score: 0.999
Data Source: BioPlex,STRINGDB
TARSL2
Tbio
Family: Enzyme
Novelty: 0.0300025
p_int: 0.999993971
p_ni: 0.000006029
Score: 0.969
Data Source: BioPlex,STRINGDB
SDCCAG8
Tbio
Novelty: 0.06798507
p_int: 0.999988727
p_ni: 0.000011152
p_wrong: 1.21e-7
Score: 0.741
Data Source: BioPlex,STRINGDB
AIMP2
Tbio
Family: Enzyme
Novelty: 0.03974199
p_int: 0.999982175
p_ni: 0.000017825
Score: 0.999
Data Source: BioPlex,STRINGDB
AIMP1
Tbio
Family: Enzyme
Novelty: 0.00828433
p_int: 0.9996742
p_ni: 0.0003258
Score: 0.998
Data Source: BioPlex,STRINGDB
DARS
Tbio
Family: Enzyme
Novelty: 0.01186323
p_int: 0.999149756
p_ni: 0.000850244
Score: 0.994
Data Source: BioPlex,STRINGDB
EPRS
Tchem
Family: Enzyme
Novelty: 0.00072148
p_int: 0.998884029
p_ni: 0.001115971
Score: 0.999
Data Source: BioPlex,STRINGDB
EEF1E1
Tbio
Novelty: 0.07766287
p_int: 0.998835167
p_ni: 0.001164833
Score: 0.994
Data Source: BioPlex,STRINGDB
IARS
Tchem
Family: Enzyme
Novelty: 0.0033571
p_int: 0.998494698
p_ni: 0.001505302
Score: 0.999
Data Source: BioPlex,STRINGDB
LARS
Tchem
Family: Enzyme
Novelty: 0.00167582
p_int: 0.998340387
p_ni: 0.001659613
Score: 0.998
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  304.17

PubMed score by year
PubTator Score  138.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEES
1-70
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGG
70-140
KLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCL
140-210
HMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVA
210-280
KPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDL
280-350
MEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR
350-420
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFV
420-490
MKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTD
490-560
SNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
560-597
MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV