You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SART3
Squamous cell carcinoma antigen recognized by T-cells 3

Protein Summary
Description
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites (PubMed:14749385). May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly (PubMed:20595234). May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair (PubMed:24526689). Ma ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000228284
  • ENSP00000228284
  • ENSG00000075856
  • ENST00000431469
  • ENSP00000414453
  • ENST00000546611
  • ENSP00000448554
  • ENST00000546728
  • ENSP00000449743

Symbol
  • KIAA0156
  • TIP110
  • P100
  • p110
  • DSAP1
  • TIP110
  • p110(nrb)
  • RP11-13G14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
transcription factor binding site profile
0.91
disease perturbation
0.9
kinase perturbation
0.88
transcription factor perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.39   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 223   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.39   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 223   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (23)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (168)
1 – 10 of 168
PRPF3
Tbio
Novelty: 0.01841457
p_int: 0.999999999
p_ni: 1e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
SNRPN
Tbio
Novelty: 0.00241221
p_int: 0.999999999
p_ni: 1e-9
Score: 0.534
Data Source: BioPlex,STRINGDB
TUT1
Tbio
Family: Enzyme
Novelty: 0.0189148
p_int: 0.99999995
p_ni: 5e-8
Score: 0.753
Data Source: BioPlex,STRINGDB
RPS26P11
Tdark
p_int: 0.999999421
p_ni: 5.74e-7
p_wrong: 5e-9
Data Source: BioPlex
PRPF31
Tbio
Novelty: 0.01263898
p_int: 0.999997533
p_ni: 0.000002467
Score: 0.963
Data Source: BioPlex,STRINGDB
LSM6
Tdark
Novelty: 0.24061873
p_int: 0.999957463
p_ni: 0.000042537
Score: 0.938
Data Source: BioPlex,STRINGDB
MEPCE
Tbio
Novelty: 0.10682371
p_int: 0.99994998
p_ni: 0.00005002
Score: 0.927
Data Source: BioPlex,STRINGDB
PRPF4
Tchem
Novelty: 0.15261686
p_int: 0.999800223
p_ni: 0.000199777
Score: 0.892
Data Source: BioPlex,STRINGDB
ZSCAN21
Tbio
Family: TF
Novelty: 0.20708881
p_int: 0.999488563
p_ni: 0.000509985
p_wrong: 0.000001452
Data Source: BioPlex
USP4
Tbio
Family: Enzyme
Novelty: 0.00872265
p_int: 0.998182934
p_ni: 0.001817066
Score: 0.978
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  42.39

PubMed score by year
PubTator Score  138.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEY
1-70
AMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSE
70-140
IFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVF
140-210
ERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPES
210-280
VIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRY
280-350
SQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI
350-420
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQ
420-490
KARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLE
490-560
DWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDE
560-630
KEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSS
630-700
KDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSV
700-770
EGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP
770-840
KGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGR
840-910
TQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK
910-963
MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK