You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GRM4
Metabotropic glutamate receptor 4

Protein Summary
Description
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374177
  • ENSP00000363292
  • ENSG00000124493
  • ENST00000455714
  • ENSP00000398456
  • ENST00000535756
  • ENSP00000437925
  • ENST00000538487
  • ENSP00000440556
  • ENST00000544773
  • ENSP00000437730
  • ENST00000609222
  • ENSP00000477466

Symbol
  • GPRC1D
  • MGLUR4
  • mGlu4
  • GPRC1D
  • MGLUR4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
ligand (chemical)
0.9
co-expressed gene
0.87
biological process
0.73
cellular component
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.36   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 206   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 233.36   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 206   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 77
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
dexfosfoserine
chemical structure image
Pathways (25)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (297)
1 – 10 of 297
HRH3
Tclin
Family: GPCR
Novelty: 0.00180244
Score: 0.949
Data Source: STRINGDB
HTR1A
Tclin
Family: GPCR
Novelty: 0.00019966
Score: 0.946
Data Source: STRINGDB
DRD2
Tclin
Family: GPCR
Novelty: 0.00028344
Score: 0.943
Data Source: STRINGDB
CNR1
Tclin
Family: GPCR
Novelty: 0.00017618
Score: 0.941
Data Source: STRINGDB
ADORA1
Tclin
Family: GPCR
Novelty: 0.0005245
Score: 0.941
Data Source: STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.937
Data Source: STRINGDB
DRD3
Tclin
Family: GPCR
Novelty: 0.00058433
Score: 0.934
Data Source: STRINGDB
TAS2R40
Tbio
Family: GPCR
Novelty: 1.02439024
Score: 0.934
Data Source: STRINGDB
GABBR1
Tclin
Family: GPCR
Novelty: 0.00136121
Score: 0.933
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.933
Data Source: STRINGDB
Publication Statistics
PubMed Score  233.36

PubMed score by year
PubTator Score  39.96

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGEL
1-70
KKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGG
70-140
PPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMV
140-210
DIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARA
210-280
VIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSS
280-350
RTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
350-420
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYK
420-490
VIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTC
490-560
PYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLL
560-630
AGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQL
630-700
AITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVY
700-770
AIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
770-840
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNH
840-910
AI
910-912
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHALHAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMPKVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNHAI