You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MEF2D
Myocyte-specific enhancer factor 2D

Protein Summary
Description
Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis (By similarity). This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in l ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000348159
  • ENSP00000271555
  • ENSG00000116604
  • ENST00000360595
  • ENSP00000353803
  • ENST00000464356
  • ENSP00000476788
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
transcription factor binding site profile
0.97
transcription factor perturbation
0.88
hub protein
0.85
PubMedID
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 119.95   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 408   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 119.95   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 408   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (23)
Circadian Clock (R-HSA-400253)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Circadian Clock
Reactome
Developmental Biology
Reactome
Mitochondrial biogenesis
Reactome
Myogenesis
Reactome
Organelle biogenesis and maintenance
Name
Explore in Pharos
Explore in Source
Circadian Clock
Developmental Biology
Mitochondrial biogenesis
Myogenesis
Organelle biogenesis and maintenance
Gene Ontology Terms (25)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (121)
1 – 10 of 121
MEF2B
Tbio
Family: TF
Novelty: 0.02665536
p_int: 0.999999974
p_ni: 9e-9
p_wrong: 1.7e-8
Score: 0.172
Data Source: BioPlex,STRINGDB
WRAP53
Tbio
Family: Enzyme
Novelty: 0.02564456
p_int: 0.99999902
p_ni: 9.73e-7
p_wrong: 8e-9
Data Source: BioPlex
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
p_int: 0.994952324
p_ni: 0.000004268
p_wrong: 0.005043408
Score: 0.959
Data Source: BioPlex,STRINGDB
CABIN1
Tbio
Novelty: 0.00039531
Score: 0.99
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.988
Data Source: STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.981
Data Source: STRINGDB
MYOG
Tbio
Family: TF
Novelty: 0.00099383
Score: 0.98
Data Source: STRINGDB
HDAC5
Tclin
Family: Epigenetic
Novelty: 0.00560014
Score: 0.979
Data Source: STRINGDB
MYOD1
Tbio
Family: TF
Novelty: 0.00064991
Score: 0.978
Data Source: STRINGDB
MAPK7
Tchem
Family: Kinase
Novelty: 0.00301243
Score: 0.977
Data Source: STRINGDB
Publication Statistics
PubMed Score  119.95

PubMed score by year
PubTator Score  53.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYT
1-70
EYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNF
70-140
AMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDL
140-210
NSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKG
210-280
LMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF
280-350
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
350-420
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDF
420-490
GPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
490-521
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK