You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GANAB
Neutral alpha-glucosidase AB

Protein Classes
Protein Summary
Description
Catalytic subunit of glucosidase II that cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins (PubMed:10929008). Required for PKD1/Polycystin-1 and PKD2/Polycystin-2 maturation and localization to the cell surface and cilia (PubMed:27259053). This gene encodes the alpha subunit of glucosidase II and a member of the glycosyl hydrolase 31 family of proteins. The heterodimeric enzyme glucosidase II plays a role in protein folding and quality control by cleaving glucose residues from immature glycoproteins in the endoplasmic reticulum. Expression of the encoded protein is elevated in lung tumor tissue and in response to UV irradiation. Mutations in this gene cause autosomal-dominant polycystic kidney and liver disease. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000346178
  • ENSP00000340466
  • ENSG00000089597
  • ENST00000356638
  • ENSP00000349053
  • ENST00000526210
  • ENSP00000433799
  • ENST00000532402
  • ENSP00000432181
  • ENST00000534613
  • ENSP00000434921

Symbol
  • G2AN
  • KIAA0088
  • G2AN
  • GIIA
  • PKD3
  • GLUII
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.99
disease perturbation
0.99
cellular component
0.73
tissue sample
0.69
transcription factor binding site profile
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.74   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 167   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.74   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 167   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Calnexin/calreticulin cycle
Reactome
Metabolism of proteins
Reactome
N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Calnexin/calreticulin cycle
Metabolism of proteins
N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Post-translational protein modification
Gene Ontology Terms (12)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (73)
1 – 10 of 73
UBAC1
Tbio
Novelty: 0.00195339
p_int: 0.949077858
p_ni: 0.050922142
Data Source: BioPlex
TAB1
Tchem
Family: Kinase
Novelty: 0.01006931
p_int: 0.947392338
p_ni: 0.052389947
p_wrong: 0.000217715
Score: 0.326
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.946665422
p_ni: 0.053334578
Score: 0.287
Data Source: BioPlex,STRINGDB
CCT2
Tbio
Novelty: 0.03021537
p_int: 0.92965123
p_ni: 0.07034877
Score: 0.257
Data Source: BioPlex,STRINGDB
CCT3
Tbio
Novelty: 0.00555442
p_int: 0.905227616
p_ni: 0.094772384
Score: 0.578
Data Source: BioPlex,STRINGDB
ZNF703
Tbio
Novelty: 0.05197807
p_int: 0.86432693
p_ni: 0.135673053
p_wrong: 1.7e-8
Score: 0.309
Data Source: BioPlex,STRINGDB
TCP1
Tbio
Novelty: 0.00509212
p_int: 0.83507758
p_ni: 0.16492242
Score: 0.256
Data Source: BioPlex,STRINGDB
RUFY3
Tdark
Novelty: 0.45584046
p_int: 0.824991941
p_ni: 0.175008059
Score: 0.19
Data Source: BioPlex,STRINGDB
CCT5
Tbio
Novelty: 0.02957327
p_int: 0.796164021
p_ni: 0.203835979
Score: 0.225
Data Source: BioPlex,STRINGDB
CCT6A
Tbio
Novelty: 0.03886926
p_int: 0.759103382
p_ni: 0.240896618
Score: 0.185
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  58.74

PubMed score by year
PubTator Score  29.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLG
1-70
PDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVEL
70-140
TMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDK
140-210
PEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLY
210-280
NLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQ
280-350
TDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
350-420
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYV
420-490
KTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDA
490-560
QHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISI
560-630
PMCLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDA
630-700
LGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLP
700-770
GQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
770-840
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGS
840-910
PESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
910-944
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR