You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MELK
Maternal embryonic leucine zipper kinase

Protein Summary
Description
Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298048
  • ENSP00000298048
  • ENSG00000165304
  • ENST00000536329
  • ENSP00000443550
  • ENST00000536860
  • ENSP00000439792
  • ENST00000536987
  • ENSP00000439184
  • ENST00000541717
  • ENSP00000437804
  • ENST00000543751
  • ENSP00000441596
  • ENST00000545008
  • ENSP00000445452

Symbol
  • KIAA0175
  • HPK38
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
molecular function
0.97
interacting protein
0.96
protein domain
0.92
histone modification site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.11   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 436   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.11   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 436   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 605
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
nintedanib
chemical structure image
Protein Data Bank (29)
1 – 5 of 29
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (242)
1 – 10 of 242
CTAG2
Tbio
Novelty: 0.02972518
p_int: 0.999568637
p_ni: 0.000431363
Data Source: BioPlex
RHPN1
Tbio
Novelty: 0.11250959
p_int: 0.999537643
p_ni: 0.000462357
Score: 0.152
Data Source: BioPlex,STRINGDB
PCDHGA5
Tdark
p_int: 0.997383985
p_ni: 0.002615992
p_wrong: 2.3e-8
Data Source: BioPlex
MFAP5
Tbio
Novelty: 0.02976267
p_int: 0.97253637
p_ni: 0.02746363
Data Source: BioPlex
CBWD1
Tbio
Novelty: 0.04454343
p_int: 0.963266901
p_ni: 0.036733093
p_wrong: 6e-9
Data Source: BioPlex
IL13RA2
Tbio
Novelty: 0.04900852
p_int: 0.957502487
p_ni: 0.042497459
p_wrong: 5.4e-8
Data Source: BioPlex
SPACA1
Tbio
Novelty: 0.14150943
p_int: 0.933543539
p_ni: 0.066455944
p_wrong: 5.17e-7
Data Source: BioPlex
PROZ
Tbio
Family: Enzyme
Novelty: 0.04928676
p_int: 0.925055005
p_ni: 0.074944849
p_wrong: 1.46e-7
Data Source: BioPlex
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.919101626
p_ni: 0.080895197
p_wrong: 0.000003177
Data Source: BioPlex
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.901946873
p_ni: 0.098052429
p_wrong: 6.98e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  116.11

PubMed score by year
PubTator Score  79.02

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHIC
1-70
QLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLF
70-140
DEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFD
140-210
DDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFI
210-280
HLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDI
280-350
KSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
350-420
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTD
420-490
KLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLH
490-560
YNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQR
560-630
LKGDAWVYKRLVEDILSSCKV
630-651
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV