You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
INPP5A
Type I inositol 1,4,5-trisphosphate 5-phosphatase

Protein Summary
Description
Major isoenzyme hydrolyzing the calcium-mobilizing second messenger Ins(1,4,5)P3, this is a signal-terminating reaction. The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368594
  • ENSP00000357583
  • ENSG00000068383

Symbol
  • 5PTASE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
transcription factor binding site profile
0.82
transcription factor perturbation
0.8
kinase perturbation
0.76
tissue sample
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.63   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 148   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.63   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 148   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Inositol phosphate metabolism (R-HSA-1483249)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Inositol phosphate metabolism
Reactome
Metabolism
Reactome
Synthesis of IP2, IP, and Ins in the cytosol
Name
Explore in Pharos
Explore in Source
Inositol phosphate metabolism
Metabolism
Synthesis of IP2, IP, and Ins in the cytosol
Gene Ontology Terms (10)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (90)
1 – 10 of 90
RABGGTB
Tbio
Family: Enzyme
Novelty: 0.13346044
p_int: 0.999983032
p_ni: 0.000016967
p_wrong: 1e-9
Data Source: BioPlex
ITFG2
Tbio
Novelty: 0.816
p_int: 0.999114421
p_ni: 0.000885579
Score: 0.234
Data Source: BioPlex,STRINGDB
RCCD1
Tbio
Novelty: 0.10479042
p_int: 0.996573796
p_ni: 0.003426204
Score: 0.381
Data Source: BioPlex,STRINGDB
TTR
Tclin
Novelty: 0.00009876
p_int: 0.962010511
p_ni: 0.037989484
p_wrong: 4e-9
Data Source: BioPlex
SLC25A41
Tdark
Family: Transporter
Novelty: 2.02597403
p_int: 0.919229853
p_ni: 0.080770129
p_wrong: 1.8e-8
Data Source: BioPlex
DUSP22
Tbio
Family: Enzyme
Novelty: 0.02012116
p_int: 0.915923799
p_ni: 0.084076195
p_wrong: 6e-9
Data Source: BioPlex
IGHA1
Tbio
p_int: 0.877222596
p_ni: 0.122777404
Data Source: BioPlex
C11orf87
Tdark
p_int: 0.846837449
p_ni: 0.103752969
p_wrong: 0.049409582
Data Source: BioPlex
ISOC2
Tbio
Family: Enzyme
Novelty: 0.5625
p_int: 0.843897682
p_ni: 0.154441442
p_wrong: 0.001660875
Score: 0.167
Data Source: BioPlex,STRINGDB
MED21
Tbio
Family: Enzyme
Novelty: 0.07350796
p_int: 0.814062591
p_ni: 0.185172694
p_wrong: 0.000764715
Data Source: BioPlex
Publication Statistics
PubMed Score  24.63

PubMed score by year
PubTator Score  17.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDK
1-70
FVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTL
70-140
ESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKAL
140-210
GYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQ
210-280
LEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR
280-350
ILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ
350-412
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ