You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HES1
Transcription factor HES-1

Protein Summary
Description
Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage. This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000232424
  • ENSP00000232424
  • ENSG00000114315

Symbol
  • BHLHB39
  • HL
  • HRY
  • HHL
  • HRY
  • HES-1
  • bHLHb39
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
virus perturbation
1
transcription factor binding site profile
0.99
PubMedID
0.97
transcription factor
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 67.48   (req: < 5)
Gene RIFs: 121   (req: <= 3)
Antibodies: 568   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 67.48   (req: >= 5)
Gene RIFs: 121   (req: > 3)
Antibodies: 568   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 87
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (54)
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 28
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Reactome
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Reactome
Developmental Biology
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Developmental Biology
Disease
Diseases of signal transduction
Gene Ontology Terms (90)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (108)
1 – 10 of 108
TLE1
Tbio
Novelty: 0.00854022
p_int: 0.999773813
p_ni: 9.8e-8
p_wrong: 0.000226089
Score: 0.967
Data Source: BioPlex,Reactome,STRINGDB
FANCL
Tbio
Family: Enzyme
Novelty: 0.00313016
Score: 0.999
Data Source: STRINGDB
FANCC
Tbio
Novelty: 0.00491734
Score: 0.999
Data Source: STRINGDB
FANCF
Tchem
Novelty: 0.02529231
Score: 0.999
Data Source: STRINGDB
FANCA
Tbio
Novelty: 0.00397648
Score: 0.999
Data Source: STRINGDB
FANCG
Tbio
Novelty: 0.00411649
Score: 0.999
Data Source: STRINGDB
FANCE
Tbio
Novelty: 0.07345774
Score: 0.999
Data Source: STRINGDB
NOTCH1
Tchem
Novelty: 0.00014278
Score: 0.99
Data Source: STRINGDB
NEUROG3
Tbio
Family: TF
Novelty: 0.00367513
Score: 0.968
Data Source: STRINGDB
NOTCH2
Tchem
Novelty: 0.0026339
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  67.48

PubMed score by year
PubTator Score  502.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS
1-70
RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL
70-140
GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG
140-210
EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
210-280
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN