You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GK2
Glycerol kinase 2

Protein Summary
Description
Key enzyme in the regulation of glycerol uptake and metabolism.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000358842
  • ENSP00000351706
  • ENSG00000196475

Symbol
  • GKP2
  • GKTA
  • GKP2
  • GKTA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
gene perturbation
0.81
cellular component
0.62
protein domain
0.58
co-expressed gene
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.66   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 251   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.66   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 251   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (32)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Triglyceride biosynthesis
Reactome
Triglyceride metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
Triglyceride biosynthesis
Triglyceride metabolism
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (54)
1 – 10 of 54
GK
Tbio
Family: Kinase
Novelty: 0.00835719
p_int: 0.999995109
p_ni: 3e-9
p_wrong: 0.000004888
Score: 0.807
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.791612387
p_ni: 0.208387613
Score: 0.295
Data Source: BioPlex,STRINGDB
GPD2
Tbio
Family: Enzyme
Novelty: 0.01150366
Score: 0.98
Data Source: STRINGDB
AKR1B10
Tchem
Family: Enzyme
Novelty: 0.00276847
Score: 0.914
Data Source: STRINGDB
AKR1A1
Tchem
Family: Enzyme
Novelty: 0.00656392
Score: 0.914
Data Source: STRINGDB
AKR1B1
Tclin
Family: Enzyme
Novelty: 0.00050572
Score: 0.914
Data Source: STRINGDB
GPAT4
Tbio
Family: Enzyme
Novelty: 0.04994969
Score: 0.912
Data Source: STRINGDB
GPAM
Tbio
Family: Enzyme
Novelty: 0.00895841
Score: 0.907
Data Source: STRINGDB
GPAT3
Tbio
Family: Enzyme
Novelty: 0.05392755
Score: 0.907
Data Source: STRINGDB
GPAT2
Tbio
Family: Enzyme
Novelty: 0.0514769
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.66

PubMed score by year
PubTator Score  26.7

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIAR
1-70
TCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSK
70-140
TGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
140-210
HSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYG
210-280
TGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAK
280-350
EVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
350-420
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQ
420-490
IQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSMVMLIGARYISGVP
490-553
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSMVMLIGARYISGVP