You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LRRC32
Transforming growth factor beta activator LRRC32

Protein Classes
Protein Summary
Description
Key regulator of transforming growth factor beta (TGFB1, TGFB2 and TGFB3) that controls TGF-beta activation by maintaining it in a latent state during storage in extracellular space (PubMed:19750484, PubMed:19651619, PubMed:22278742). Associates specifically via disulfide bonds with the Latency-associated peptide (LAP), which is the regulatory chain of TGF-beta, and regulates integrin-dependent activation of TGF-beta (PubMed:22278742). Able to outcompete LTBP1 for binding to LAP regulatory chain of TGF-beta (PubMed:22278742). Controls activation of TGF-beta-1 (TGFB1) on the surface of activated regulatory T-cells (Tregs) (PubMed:19750484, PubMed:19651619). Required for epithelial fusion during palate development by regulating activation of TGF-beta-3 (TGFB3) (By similarity). This gene encodes a type I membrane protein which contains 20 leucine-rich repeats. Alterations in the chromosomal region 11q13-11q14 are involved in several pathologies. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260061
  • ENSP00000260061
  • ENSG00000137507
  • ENST00000404995
  • ENSP00000385766
  • ENST00000407242
  • ENSP00000384126

Symbol
  • D11S833E
  • GARP
  • D11S833E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.71
transcription factor
0.53
gene perturbation
0.52
biological process
0.51
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.58   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 280   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.58   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 280   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (13)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (44)
1 – 10 of 44
ZDHHC6
Tbio
Family: Enzyme
Novelty: 0.25862069
p_int: 0.999508707
p_ni: 0.000491293
Score: 0.167
Data Source: BioPlex,STRINGDB
TGFB1
Tchem
Novelty: 0.00014007
p_int: 0.998888885
p_ni: 0.001111115
Score: 0.417
Data Source: BioPlex,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
p_int: 0.997710607
p_ni: 0.002289391
p_wrong: 3e-9
Score: 0.25
Data Source: BioPlex,STRINGDB
DCP2
Tbio
Family: Enzyme
Novelty: 0.00984421
p_int: 0.994813414
p_ni: 0.004047712
p_wrong: 0.001138874
Score: 0.179
Data Source: BioPlex,STRINGDB
SMPD2
Tchem
Family: Enzyme
Novelty: 0.00474009
p_int: 0.987782383
p_ni: 0.012217438
p_wrong: 1.79e-7
Score: 0.185
Data Source: BioPlex,STRINGDB
SLC16A10
Tbio
Family: Transporter
Novelty: 0.03767726
p_int: 0.980895034
p_ni: 0.019061761
p_wrong: 0.000043205
Score: 0.163
Data Source: BioPlex,STRINGDB
TMEM11
Tbio
Novelty: 0.00132758
p_int: 0.974486275
p_ni: 0.009508865
p_wrong: 0.01600486
Score: 0.185
Data Source: BioPlex,STRINGDB
STK11IP
Tdark
Family: Enzyme
Novelty: 0.50209205
p_int: 0.939918884
p_ni: 0.060081116
Score: 0.188
Data Source: BioPlex,STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.844799312
p_ni: 0.155200688
Data Source: BioPlex
LEMD3
Tbio
Novelty: 0.00728793
p_int: 0.843323256
p_ni: 0.156676744
Data Source: BioPlex
Publication Statistics
PubMed Score  44.58

PubMed score by year
PubTator Score  67.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLG
1-70
FYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGL
70-140
LERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLT
140-210
CISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLP
210-280
TGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNC
280-350
LRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
350-420
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLE
420-490
ASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLE
490-560
TSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLII
560-630
ILTFILVSAILLTTLAACCCVRRQKFNQQYKA
630-662
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA