You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EIF3A
Eukaryotic translation initiation factor 3 subunit A

Protein Summary
Description
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632, PubMed:11169732). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369144
  • ENSP00000358140
  • ENSG00000107581
  • ENST00000541549
  • ENSP00000438178

Symbol
  • EIF3S10
  • KIAA0139
  • EIF3
  • P167
  • p180
  • p185
  • TIF32
  • EIF3S10
  • eIF3-p170
  • eIF3-theta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
transcription factor perturbation
0.96
hub protein
0.88
virus perturbation
0.88
transcription factor binding site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.62   (req: < 5)
Gene RIFs: 48   (req: <= 3)
Antibodies: 252   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.62   (req: >= 5)
Gene RIFs: 48   (req: > 3)
Antibodies: 252   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (R-HSA-72662)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Reactome
Cap-dependent Translation Initiation
Reactome
Eukaryotic Translation Initiation
Reactome
Formation of a pool of free 40S subunits
Reactome
Formation of the ternary complex, and subsequently, the 43S complex
Name
Explore in Pharos
Explore in Source
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Cap-dependent Translation Initiation
Eukaryotic Translation Initiation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Gene Ontology Terms (24)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Protein-Protein Interactions (324)
1 – 10 of 324
EIF3E
Tbio
Novelty: 0.02690754
p_int: 0.999995496
p_ni: 0.000004504
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3M
Tbio
Novelty: 0.02340046
p_int: 0.999991829
p_ni: 0.000008171
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3H
Tbio
Novelty: 0.03294676
p_int: 0.999990805
p_ni: 0.000009195
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3I
Tbio
Novelty: 0.07521172
p_int: 0.999989646
p_ni: 0.000010354
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3D
Tbio
Novelty: 0.05637435
p_int: 0.999974041
p_ni: 0.000025959
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3L
Tbio
Novelty: 0.1477297
p_int: 0.999973584
p_ni: 0.000026416
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3F
Tbio
Novelty: 0.03659119
p_int: 0.999936373
p_ni: 0.000063627
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF3G
Tbio
Novelty: 0.06880717
p_int: 0.999847015
p_ni: 0.000152985
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF4A1
Tchem
Novelty: 0.0043238
p_int: 0.992818894
p_ni: 0.007181106
Score: 0.988
Data Source: BioPlex,STRINGDB
RSPH9
Tbio
Novelty: 0.12094399
p_int: 0.983007521
p_ni: 0.016992479
Score: 0.722
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  184.62

PubMed score by year
PubTator Score  329.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEG
1-70
LYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR
70-140
TDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQR
140-210
HHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVS
210-280
TVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVE
280-350
KQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
350-420
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRT
420-490
LSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKN
490-560
SRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQ
560-630
IKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFER
630-700
AKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQS
700-770
VYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
770-840
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWR
840-910
RGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRR
910-980
GADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRR
980-1050
GGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPW
1050-1120
RNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWG
1120-1190
PPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWR
1190-1260
DSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRV
1260-1330
PPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR
1330-1382
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR