You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DAG1
Dystroglycan

Protein Classes
Protein Summary
Description
The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sarcolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization. Alpha-dystroglycan is an extracellular peripheral glycoprotein that acts as a receptor for both extracellular matrix proteins containing laminin-G domains. Receptor for laminin-2 (LAMA2) and agrin in peripheral nerve Schwann cells. Beta-dystroglycan is a transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity. (Microbial infection) Alpha-dystroglycan acts as a receptor for lassa virus and lymphocytic choriomeningitis virus glycoprotein and class ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308775
  • ENSP00000312435
  • ENSG00000173402
  • ENST00000515359
  • ENSP00000440705
  • ENST00000538711
  • ENSP00000438421
  • ENST00000539901
  • ENSP00000439334
  • ENST00000541308
  • ENSP00000440590
  • ENST00000545947
  • ENSP00000442600

Symbol
  • A3a
  • DAG
  • AGRNR
  • 156DAG
  • MDDGA9
  • MDDGC7
  • MDDGC9
  • LGMDR16
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
transcription factor perturbation
0.98
biological process
0.93
molecular function
0.9
kinase perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 493.16   (req: < 5)
Gene RIFs: 67   (req: <= 3)
Antibodies: 337   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 493.16   (req: >= 5)
Gene RIFs: 67   (req: > 3)
Antibodies: 337   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 45
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Defective POMGNT1 causes MDDGA3, MDDGB3 and MDDGC3
Reactome
Defective POMT1 causes MDDGA1, MDDGB1 and MDDGC1
Reactome
Defective POMT2 causes MDDGA2, MDDGB2 and MDDGC2
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
Axon guidance
Defective POMGNT1 causes MDDGA3, MDDGB3 and MDDGC3
Defective POMT1 causes MDDGA1, MDDGB1 and MDDGC1
Defective POMT2 causes MDDGA2, MDDGB2 and MDDGC2
Developmental Biology
Gene Ontology Terms (76)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (165)
1 – 10 of 165
LGALS9
Tchem
Novelty: 0.00463223
p_int: 0.999999289
p_ni: 7.11e-7
Data Source: BioPlex
PCDHGA5
Tdark
p_int: 0.999756494
p_ni: 0.000243506
Data Source: BioPlex
PCDHGB4
Tdark
Novelty: 0.62001206
p_int: 0.999233509
p_ni: 0.000766491
Data Source: BioPlex
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.99909176
p_ni: 0.00090824
Data Source: BioPlex
GINM1
Tdark
p_int: 0.998779617
p_ni: 0.001220382
Data Source: BioPlex
CEACAM21
Tdark
Novelty: 0.98765432
p_int: 0.998312301
p_ni: 0.001686187
p_wrong: 0.000001512
Data Source: BioPlex
TNF
Tclin
Novelty: 0.00001974
p_int: 0.997018043
p_ni: 0.002981832
p_wrong: 1.25e-7
Score: 0.205
Data Source: BioPlex,STRINGDB
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.995277091
p_ni: 0.004716987
p_wrong: 0.000005922
Data Source: BioPlex
PCDHB11
Tdark
Novelty: 1.5
p_int: 0.990503171
p_ni: 0.009496828
Data Source: BioPlex
TMEM106A
Tdark
Novelty: 0.49469965
p_int: 0.990205169
p_ni: 0.009794792
p_wrong: 3.9e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  493.16

PubMed score by year
PubTator Score  282.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDG
1-70
TAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
70-140
NGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDL
140-210
LHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAP
210-280
AREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPP
280-350
TETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
350-420
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRG
420-490
GEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQL
490-560
MYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALV
560-630
KKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDF
630-700
KATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGII
700-770
AMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
770-840
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
840-895
MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP