You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KLF5
Krueppel-like factor 5

Protein Summary
Description
Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes. This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream of multiple different signaling pathways and is regulated by post-translational modification. It may participate in both promoting and suppressing cell proliferation. Expression of this gene may be changed in a variety of different cancers and in cardiovascular disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377687
  • ENSP00000366915
  • ENSG00000102554
  • ENST00000539231
  • ENSP00000440407

Symbol
  • BTEB2
  • CKLF
  • IKLF
  • CKLF
  • IKLF
  • BTEB2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.98
transcription factor binding site profile
0.91
hub protein
0.9
biological process
0.87
molecular function
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 252.92   (req: < 5)
Gene RIFs: 124   (req: <= 3)
Antibodies: 297   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 252.92   (req: >= 5)
Gene RIFs: 124   (req: > 3)
Antibodies: 297   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Transcriptional regulation of granulopoiesis
Reactome
Transcriptional regulation of white adipocyte differentiation
Name
Explore in Pharos
Explore in Source
Developmental Biology
Transcriptional regulation of granulopoiesis
Transcriptional regulation of white adipocyte differentiation
Gene Ontology Terms (25)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (101)
1 – 10 of 101
NEDD4L
Tbio
Family: Enzyme
Novelty: 0.00294229
p_int: 0.999878953
p_ni: 0.000121047
Data Source: BioPlex
IVNS1ABP
Tbio
Novelty: 0.07657271
p_int: 0.991866366
p_ni: 0.004330862
p_wrong: 0.003802772
Data Source: BioPlex
PUS1
Tbio
Family: Enzyme
Novelty: 0.02324552
p_int: 0.987477042
p_ni: 0.012522958
Data Source: BioPlex
CEBPB
Tbio
Family: TF
Novelty: 0.00076161
Score: 0.979
Data Source: STRINGDB
CEBPA
Tbio
Family: TF
Novelty: 0.00103676
Score: 0.976
Data Source: STRINGDB
PPARG
Tclin
Family: NR
Novelty: 0.00012454
Score: 0.962
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.948
Data Source: STRINGDB
CEBPD
Tbio
Family: TF
Novelty: 0.00289107
Score: 0.939
Data Source: STRINGDB
EBF1
Tbio
Family: TF
Novelty: 0.00140598
Score: 0.928
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.782
Data Source: STRINGDB
Publication Statistics
PubMed Score  252.92

PubMed score by year
PubTator Score  138.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQP
1-70
AQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFL
70-140
PDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQ
140-210
ELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQG
210-280
MPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVN
280-350
SQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
350-420
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
420-457
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN