You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PTK6
Protein-tyrosine kinase 6

Protein Summary
Description
Non-receptor tyrosine-protein kinase implicated in the regulation of a variety of signaling pathways that control the differentiation and maintenance of normal epithelia, as well as tumor growth. Function seems to be context dependent and differ depending on cell type, as well as its intracellular localization. A number of potential nuclear and cytoplasmic substrates have been identified. These include the RNA-binding proteins: KHDRBS1/SAM68, KHDRBS2/SLM1, KHDRBS3/SLM2 and SFPQ/PSF; transcription factors: STAT3 and STAT5A/B and a variety of signaling molecules: ARHGAP35/p190RhoGAP, PXN/paxillin, BTK/ATK, STAP2/BKS. Associates also with a variety of proteins that are likely upstream of PTK6 in various signaling pathways, or for which PTK6 may play an adapter-like role. These proteins include ADAM15, EGFR, ERBB2, ERBB3 and IRS4. In normal or non-tumorigenic tissues, PTK6 promotes cellular differentiation and apoptosis. In tumors PTK6 contributes to cancer progression by sensitizing cells ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000217185
  • ENSP00000217185
  • ENSG00000101213
  • ENST00000542869
  • ENSP00000442460

Symbol
  • BRK
  • BRK
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
molecular function
0.95
biological process
0.89
biological term
0.57
gene perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 191.73   (req: < 5)
Gene RIFs: 73   (req: <= 3)
Antibodies: 478   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 191.73   (req: >= 5)
Gene RIFs: 73   (req: > 3)
Antibodies: 478   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 51
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
dasatinib
chemical structure image
ibrutinib
chemical structure image
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 24
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cyclin A:Cdk2-associated events at S phase entry
Reactome
Cyclin D associated events in G1
Reactome
Cyclin E associated events during G1/S transition
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Cyclin A:Cdk2-associated events at S phase entry
Cyclin D associated events in G1
Cyclin E associated events during G1/S transition
Gene Ontology Terms (30)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (83)
1 – 10 of 83
KHDRBS1
Tbio
Novelty: 0.00737623
Score: 0.988
Data Source: Reactome,STRINGDB
STAP2
Tbio
Novelty: 0.0060675
Score: 0.984
Data Source: Reactome,STRINGDB
PXN
Tbio
Novelty: 0.00103853
Score: 0.971
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.968
Data Source: Reactome,STRINGDB
ARHGAP35
Tbio
Family: Enzyme
Novelty: 0.01196157
Score: 0.967
Data Source: Reactome,STRINGDB
BCAR1
Tbio
Novelty: 0.00402253
Score: 0.964
Data Source: Reactome,STRINGDB
KHDRBS3
Tbio
Novelty: 0.00301036
Score: 0.964
Data Source: Reactome,STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.953
Data Source: Reactome,STRINGDB
KHDRBS2
Tbio
Novelty: 0.04072144
Score: 0.953
Data Source: Reactome,STRINGDB
ERBB2
Tclin
Family: Kinase
Novelty: 0.00004664
Score: 0.952
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  191.73

PubMed score by year
PubTator Score  94.84

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAER
1-70
ETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLN
70-140
EAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLW
140-210
KDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSD
210-280
EKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP
280-350
YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
350-420
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
420-451
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT