You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NCOA4
Nuclear receptor coactivator 4

Protein Summary
Description
Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma. This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000578454
  • ENSP00000463027
  • ENSG00000266412
  • ENST00000579039
  • ENSP00000463455
  • ENST00000581486
  • ENSP00000462943
  • ENST00000583565
  • ENSP00000463476
  • ENST00000585132
  • ENSP00000464054

Symbol
  • ARA70
  • ELE1
  • RFG
  • RFG
  • ELE1
  • PTC3
  • ARA70
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
disease perturbation
0.9
transcription factor binding site profile
0.89
transcription factor perturbation
0.74
transcription factor
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 151.85   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 345   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 151.85   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 345   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (70)
1 – 10 of 70
GMCL1
Tbio
Novelty: 0.1349742
p_int: 0.999803746
p_ni: 0.00019473
p_wrong: 0.000001524
Score: 0.183
Data Source: BioPlex,STRINGDB
RNF10
Tbio
Novelty: 0.12240086
p_int: 0.999637984
p_ni: 0.00013658
p_wrong: 0.000225436
Data Source: BioPlex
PRELID2
Tdark
Novelty: 0.66331658
p_int: 0.999404899
p_ni: 0.000204141
p_wrong: 0.00039096
Data Source: BioPlex
HERC2
Tbio
Family: Enzyme
Novelty: 0.05519779
p_int: 0.999383791
p_ni: 0.000616209
Score: 0.506
Data Source: BioPlex,STRINGDB
NEURL4
Tdark
Novelty: 0.26030369
p_int: 0.998118432
p_ni: 0.001881568
Score: 0.298
Data Source: BioPlex,STRINGDB
FTH1
Tbio
Novelty: 0.00088724
p_int: 0.98956274
p_ni: 0.01043726
Score: 0.952
Data Source: BioPlex,STRINGDB
FTL
Tbio
Novelty: 0.00317807
p_int: 0.981822336
p_ni: 0.01817764
p_wrong: 2.5e-8
Score: 0.957
Data Source: BioPlex,STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.998
Data Source: STRINGDB
RET
Tclin
Family: Kinase
Novelty: 0.00035491
Score: 0.966
Data Source: STRINGDB
CCDC6
Tbio
Novelty: 0.01216915
Score: 0.944
Data Source: STRINGDB
Publication Statistics
PubMed Score  151.85

PubMed score by year
PubTator Score  152.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL
1-70
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF
70-140
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP
140-210
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS
210-280
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC
280-350
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
350-420
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK
420-490
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL
490-560
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
560-614
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM