You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALCAM
CD166 antigen

Protein Summary
Description
Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts (PubMed:7760007, PubMed:15496415, PubMed:15048703, PubMed:16352806, PubMed:23169771, PubMed:24945728). Promotes T-cell activation and proliferation via its interactions with CD6 (PubMed:15048703, PubMed:16352806, PubMed:24945728). Contributes to the formation and maturation of the immunological synapse via its interactions with CD6 (PubMed:15294938, PubMed:16352806). Mediates homotypic interactions with cells that express ALCAM (PubMed:15496415, PubMed:16352806). Required for normal hematopoietic stem cell engraftment in the bone marrow (PubMed:24740813). Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction (PubMed:23169771). Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions (PubMed:15496415, PubMed:23169771). Required for normal organization of the lymph ves ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306107
  • ENSP00000305988
  • ENSG00000170017
  • ENST00000472644
  • ENSP00000419236

Symbol
  • MEMD
  • MEMD
  • CD166
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
PubMedID
0.98
kinase perturbation
0.93
transcription factor binding site profile
0.93
gene perturbation
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 357.5   (req: < 5)
Gene RIFs: 117   (req: <= 3)
Antibodies: 715   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 357.5   (req: >= 5)
Gene RIFs: 117   (req: > 3)
Antibodies: 715   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
L1CAM interactions
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
L1CAM interactions
Gene Ontology Terms (19)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (100)
1 – 10 of 100
CLEC4A
Tbio
Novelty: 0.02222451
p_int: 0.999998893
p_ni: 0.000001107
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.999986158
p_ni: 0.000013842
Score: 0.41
Data Source: BioPlex,STRINGDB
UPK2
Tbio
Novelty: 0.0107781
p_int: 0.999930612
p_ni: 0.000069252
p_wrong: 1.35e-7
Data Source: BioPlex
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999871494
p_ni: 0.000128504
p_wrong: 2e-9
Score: 0.608
Data Source: BioPlex,STRINGDB
LGALS9
Tchem
Novelty: 0.00463223
p_int: 0.999676396
p_ni: 0.000323277
p_wrong: 3.27e-7
Score: 0.306
Data Source: BioPlex,STRINGDB
LGALS1
Tchem
Novelty: 0.00134398
p_int: 0.999666664
p_ni: 0.000333316
p_wrong: 2e-8
Score: 0.369
Data Source: BioPlex,STRINGDB
PCDH12
Tbio
Novelty: 0.08886914
p_int: 0.998929294
p_ni: 0.001070674
p_wrong: 3.2e-8
Score: 0.163
Data Source: BioPlex,STRINGDB
APOD
Tbio
Novelty: 0.00362142
p_int: 0.993578481
p_ni: 0.006152717
p_wrong: 0.000268803
Score: 0.284
Data Source: BioPlex,STRINGDB
FBXO2
Tbio
Novelty: 0.03751923
p_int: 0.76474757
p_ni: 0.235250305
p_wrong: 0.000002125
Score: 0.173
Data Source: BioPlex,STRINGDB
CD6
Tbio
Novelty: 0.00254096
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  357.50

PubMed score by year
PubTator Score  260.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAF
1-70
RSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIV
70-140
SKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTT
140-210
KADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEE
210-280
FLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDAL
280-350
PVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
350-420
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQ
420-490
LERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKH
490-560
VNKDLGNMEENKKLEENNHKTEA
560-583
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA