You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IL10RA
Interleukin-10 receptor subunit alpha

Protein Summary
Description
Receptor for IL10; binds IL10 with a high affinity. The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Jan 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227752
  • ENSP00000227752
  • ENSG00000110324

Symbol
  • IL10R
  • CD210
  • IL10R
  • CD210a
  • CDW210A
  • HIL-10R
  • IL-10R1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.93
PubMedID
0.81
disease perturbation
0.74
virus perturbation
0.72
tissue sample
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.02   (req: < 5)
Gene RIFs: 69   (req: <= 3)
Antibodies: 781   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.02   (req: >= 5)
Gene RIFs: 69   (req: > 3)
Antibodies: 781   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-10 signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-10 signaling
Signaling by Interleukins
Protein-Protein Interactions (260)
1 – 10 of 260
IL10
Tbio
Novelty: 0.00007359
Score: 0.998
Data Source: Reactome,STRINGDB
IL10RB
Tbio
Novelty: 0.01345152
Score: 0.995
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.994
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.975
Data Source: Reactome,STRINGDB
IL22RA1
Tbio
Novelty: 0.01436658
Score: 0.962
Data Source: STRINGDB
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.96
Data Source: STRINGDB
TYK2
Tclin
Family: Kinase
Novelty: 0.00331363
Score: 0.959
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.951
Data Source: STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.946
Data Source: STRINGDB
IL22
Tbio
Novelty: 0.0031551
Score: 0.939
Data Source: STRINGDB
Publication Statistics
PubMed Score  109.02

PubMed score by year
PubTator Score  145.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWN
1-70
SISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFIL
70-140
GKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVA
140-210
SRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIF
210-280
ISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGN
280-350
REPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
350-420
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPP
420-490
ALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGS
490-560
FNSDLVTLPLISSLQSSE
560-578
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE