You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FHL3
Four and a half LIM domains protein 3

Protein Summary
Description
The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373016
  • ENSP00000362107
  • ENSG00000183386

Symbol
  • SLIM2
  • SLIM2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
0.74
cellular component
0.65
cell type or tissue
0.57
tissue sample
0.52
transcription factor binding site profile
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.39   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 152   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.39   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 152   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (61)
1 – 10 of 61
MRTFB
Tbio
Novelty: 0.04549423
p_int: 0.999999985
p_ni: 2e-9
p_wrong: 1.3e-8
Score: 0.222
Data Source: BioPlex,STRINGDB
KCTD3
Tdark
Novelty: 0.4635514
p_int: 0.999999838
p_ni: 1.62e-7
Data Source: BioPlex
TJAP1
Tbio
Novelty: 0.01176586
p_int: 0.999999796
p_ni: 2.02e-7
p_wrong: 2e-9
Score: 0.205
Data Source: BioPlex,STRINGDB
ZNF512B
Tbio
Family: TF
Novelty: 0.10218716
p_int: 0.999999775
p_ni: 2.25e-7
Score: 0.208
Data Source: BioPlex,STRINGDB
COBL
Tbio
Novelty: 0.03002386
p_int: 0.999999494
p_ni: 5.06e-7
Data Source: BioPlex
FAM122B
Tdark
Novelty: 1.84615385
p_int: 0.999998456
p_ni: 0.000001544
Score: 0.337
Data Source: BioPlex,STRINGDB
SHKBP1
Tbio
Novelty: 0.00361871
p_int: 0.999987881
p_ni: 0.000012119
Score: 0.204
Data Source: BioPlex,STRINGDB
QSER1
Tdark
Novelty: 2.55483871
p_int: 0.999951601
p_ni: 0.000048399
Score: 0.157
Data Source: BioPlex,STRINGDB
HIPK1
Tchem
Family: Kinase
Novelty: 0.20299662
p_int: 0.999948509
p_ni: 5.41e-7
p_wrong: 0.000050951
Score: 0.354
Data Source: BioPlex,STRINGDB
ZBTB21
Tbio
Family: TF
Novelty: 0.32967033
p_int: 0.999907507
p_ni: 0.000092493
Score: 0.168
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  5.39

PubMed score by year
PubTator Score  29.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR
1-70
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS
70-140
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV
140-210
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
210-280
MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP