You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CUL4A
Cullin-4A

Protein Summary
Description
Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. DCX(DET1-COP1) directs ubiquitination of JUN. DCX(DDB2) directs ubiquitination of XPC. DCX(DDB2) ubiquitinates histones H3-H4 and is required for efficient histone deposition during replication-coupled (H3.1) and replication-independent (H3.3) nucleosome assembly, probably by facilitating the transfer of H3 from ASF1A/ASF1B to other chaperones involved in histone deposition. DCX(DTL) plays a role in PCNA-dep ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375440
  • ENSP00000364589
  • ENSG00000139842
  • ENST00000375441
  • ENSP00000364590
  • ENST00000451881
  • ENSP00000389118
  • ENST00000617546
  • ENSP00000481782
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
transcription factor binding site profile
0.9
biological process
0.86
protein domain
0.85
protein complex
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.36   (req: < 5)
Gene RIFs: 85   (req: <= 3)
Antibodies: 357   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 85.36   (req: >= 5)
Gene RIFs: 85   (req: > 3)
Antibodies: 357   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (48)
DNA Damage Bypass (R-HSA-73893)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Damage Bypass
Reactome
DNA Damage Recognition in GG-NER
Reactome
DNA Repair
Reactome
Dual Incision in GG-NER
Reactome
Dual incision in TC-NER
Name
Explore in Pharos
Explore in Source
DNA Damage Bypass
DNA Damage Recognition in GG-NER
DNA Repair
Dual Incision in GG-NER
Dual incision in TC-NER
Gene Ontology Terms (32)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (295)
1 – 10 of 295
DCAF4
Tdark
Novelty: 0.32846715
p_int: 0.999929357
p_ni: 0.000070643
Score: 0.985
Data Source: BioPlex,STRINGDB
DCAF8
Tbio
Novelty: 0.27272727
p_int: 0.999925487
p_ni: 0.000074513
Score: 0.934
Data Source: BioPlex,STRINGDB
DCAF11
Tbio
Novelty: 0.12689461
p_int: 0.999923934
p_ni: 0.000076066
Score: 0.989
Data Source: BioPlex,STRINGDB
DDB2
Tbio
Novelty: 0.00809774
p_int: 0.999896428
p_ni: 0.000103572
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
WDTC1
Tbio
Novelty: 0.00004184
p_int: 0.999891733
p_ni: 0.000108267
Score: 0.935
Data Source: BioPlex,STRINGDB
DET1
Tbio
Novelty: 0.01807423
p_int: 0.999791477
p_ni: 0.000208523
Score: 0.993
Data Source: BioPlex,STRINGDB
DCAF8L2
Tdark
p_int: 0.999786613
p_ni: 0.000213387
Data Source: BioPlex
TRPC4AP
Tbio
Novelty: 0.00440674
p_int: 0.999678712
p_ni: 0.000321288
Score: 0.939
Data Source: BioPlex,STRINGDB
COPS8
Tbio
Novelty: 0.05324769
p_int: 0.999640855
p_ni: 0.000359145
Score: 0.987
Data Source: BioPlex,STRINGDB
DTL
Tbio
Novelty: 0.01976973
p_int: 0.999335019
p_ni: 0.000664981
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
Publication Statistics
PubMed Score  85.36

PubMed score by year
PubTator Score  80.95

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAV
1-70
RAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQ
70-140
DHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVD
140-210
RSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDH
210-280
STQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTA
280-350
IVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
350-420
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSK
420-490
LEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLG
490-560
KHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQS
560-630
LACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI
630-700
VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
700-759
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA