You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CUL2
Cullin-2

Protein Summary
Description
Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. ECS complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins (PubMed:27565346). May serve as a rigid scaffold in the complex and may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1. The functional specificity of the ECS complex depends on the substrate recognition component. ECS(VHL) mediates the ubiquitination of hypoxia-inducible factor (HIF).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374748
  • ENSP00000363880
  • ENSG00000108094
  • ENST00000374749
  • ENSP00000363881
  • ENST00000374751
  • ENSP00000363883
  • ENST00000421317
  • ENSP00000414095
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
interacting protein
0.93
protein domain
0.85
microRNA
0.73
transcription factor
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.88   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 454   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.88   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 454   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (53)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Axon guidance
Reactome
Cellular response to hypoxia
Reactome
Cellular responses to external stimuli
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Axon guidance
Cellular response to hypoxia
Cellular responses to external stimuli
Protein-Protein Interactions (455)
1 – 10 of 455
LRRC14
Tdark
Novelty: 1.125
p_int: 0.999999992
p_ni: 8e-9
Score: 0.176
Data Source: BioPlex,STRINGDB
FEM1C
Tbio
Novelty: 0.14895298
p_int: 0.999999973
p_ni: 2.2e-8
p_wrong: 5e-9
Score: 0.963
Data Source: BioPlex,STRINGDB
RNF187
Tbio
Family: Enzyme
Novelty: 0.29411765
p_int: 0.999999341
p_ni: 6.59e-7
Data Source: BioPlex
KLHDC10
Tdark
Novelty: 0.60606061
p_int: 0.999985242
p_ni: 0.000002824
p_wrong: 0.000011934
Score: 0.59
Data Source: BioPlex,STRINGDB
APPBP2
Tdark
Novelty: 0.26800177
p_int: 0.999969541
p_ni: 0.000030459
Score: 0.242
Data Source: BioPlex,STRINGDB
FEM1B
Tbio
Novelty: 0.07122869
p_int: 0.999965039
p_ni: 0.000034961
Score: 0.977
Data Source: BioPlex,STRINGDB
VHL
Tchem
Family: Enzyme
Novelty: 0.00323188
p_int: 0.999930261
p_ni: 0.000069716
p_wrong: 2.3e-8
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ANKRD39
Tdark
p_int: 0.999930125
p_ni: 0.000051693
p_wrong: 0.000018182
Score: 0.203
Data Source: BioPlex,STRINGDB
LRR1
Tbio
Novelty: 0.04409217
p_int: 0.999923359
p_ni: 0.000075943
p_wrong: 6.98e-7
Score: 0.968
Data Source: BioPlex,STRINGDB
KLHDC3
Tdark
Novelty: 0.27149321
p_int: 0.999877352
p_ni: 0.00012238
p_wrong: 2.68e-7
Score: 0.796
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  112.88

PubMed score by year
PubTator Score  87.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVR
1-70
HLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIG
70-140
ELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESP
140-210
FLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHA
210-280
ECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKF
280-350
VQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
350-420
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKF
420-490
NNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC
490-560
TGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKE
560-630
DIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI
630-700
QEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA
700-745
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA