You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STIM1
Stromal interaction molecule 1

Protein Summary
Description
Plays a role in mediating store-operated Ca(2+) entry (SOCE), a Ca(2+) influx following depletion of intracellular Ca(2+) stores (PubMed:15866891, PubMed:16005298, PubMed:16208375, PubMed:16537481, PubMed:16733527, PubMed:16766533, PubMed:16807233, PubMed:18854159, PubMed:19249086, PubMed:22464749, PubMed:24069340, PubMed:24351972, PubMed:24591628, PubMed:26322679, PubMed:25326555, PubMed:28219928). Acts as Ca(2+) sensor in the endoplasmic reticulum via its EF-hand domain. Upon Ca(2+) depletion, translocates from the endoplasmic reticulum to the plasma membrane where it activates the Ca(2+) release-activated Ca(2+) (CRAC) channel subunit ORAI1 (PubMed:16208375, PubMed:16537481). Involved in enamel formation (PubMed:24621671). Activated following interaction with STIMATE, leading to promote STIM1 conformational switch (PubMed:26322679). This gene encodes a type 1 transmembrane protein that mediates Ca2+ influx after depletion of intracellular Ca2+ stores by gating of store-operated Ca2+ ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300737
  • ENSP00000300737
  • ENSG00000167323
  • ENST00000527651
  • ENSP00000436208

Symbol
  • GOK
  • GOK
  • TAM
  • TAM1
  • IMD10
  • STRMK
  • D11S4896E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.91
kinase perturbation
0.88
disease perturbation
0.87
small molecule perturbation
0.76
transcription factor
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 776.56   (req: < 5)
Gene RIFs: 306   (req: <= 3)
Antibodies: 474   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 776.56   (req: >= 5)
Gene RIFs: 306   (req: > 3)
Antibodies: 474   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Reactome
Cardiac conduction
Reactome
Elevation of cytosolic Ca2+ levels
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Cardiac conduction
Elevation of cytosolic Ca2+ levels
Hemostasis
Protein-Protein Interactions (131)
1 – 10 of 131
STIM2
Tbio
Novelty: 0.01143334
p_int: 0.999999883
p_ni: 1.18e-7
Score: 0.883
Data Source: BioPlex,STRINGDB
METTL6
Tdark
Family: Enzyme
Novelty: 0.53333333
p_int: 0.999933537
p_ni: 0.000066463
Score: 0.209
Data Source: BioPlex,STRINGDB
EDEM2
Tbio
Family: Enzyme
Novelty: 0.16891213
p_int: 0.999216102
p_ni: 0.000783863
p_wrong: 3.5e-8
Data Source: BioPlex
CCDC40
Tbio
Novelty: 0.08874937
p_int: 0.998697605
p_ni: 0.001302395
Score: 0.173
Data Source: BioPlex,STRINGDB
CLDN19
Tbio
Novelty: 0.03007126
p_int: 0.998646829
p_ni: 0.001353171
Data Source: BioPlex
HAUS1
Tbio
Novelty: 0.04680423
p_int: 0.998461735
p_ni: 0.001538259
p_wrong: 7e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
LRRTM1
Tbio
Novelty: 0.05800638
p_int: 0.980815334
p_ni: 0.019184666
Data Source: BioPlex
IL17RB
Tbio
Novelty: 0.02272569
p_int: 0.976942887
p_ni: 0.023057113
Score: 0.181
Data Source: BioPlex,STRINGDB
SLC39A9
Tbio
Family: Transporter
Novelty: 0.0825498
p_int: 0.966157775
p_ni: 0.033842225
Data Source: BioPlex
CD1E
Tbio
Novelty: 0.00231902
p_int: 0.933199575
p_ni: 0.066800425
Data Source: BioPlex
Publication Statistics
PubMed Score  776.56

PubMed score by year
PubTator Score  573.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRN
1-70
IHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW
70-140
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNH
140-210
LKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKV
210-280
HLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKW
280-350
LQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
350-420
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSM
420-490
QSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLI
490-560
EGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPV
560-630
GDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
630-685
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK