You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DGKZ
Diacylglycerol kinase zeta

Protein Classes
Protein Summary
Description
Displays a strong preference for 1,2-diacylglycerols over 1,3-diacylglycerols, but lacks substrate specificity among molecular species of long chain diacylglycerols. Isoform 2 but not isoform 1 regulates RASGRP1 activity (PubMed:11257115). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity). Activates PIP5K1A activity via generation of phosphatidic acid (PubMed:15157668). The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318201
  • ENSP00000320340
  • ENSG00000149091
  • ENST00000343674
  • ENSP00000343065
  • ENST00000421244
  • ENSP00000391021
  • ENST00000454345
  • ENSP00000412178
  • ENST00000456247
  • ENSP00000395684
  • ENST00000527911
  • ENSP00000436291
  • ENST00000532868
  • ENSP00000436273

Symbol
  • DAGK6
  • DAGK5
  • DAGK6
  • DGK-ZETA
  • hDGKzeta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
transcription factor
0.86
protein domain
0.85
transcription factor perturbation
0.74
metabolite
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 92.84   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 204   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 92.84   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 204   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (43)
Effects of PIP2 hydrolysis (R-HSA-114508)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Effects of PIP2 hydrolysis
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Name
Explore in Pharos
Explore in Source
Effects of PIP2 hydrolysis
G alpha (q) signalling events
GPCR downstream signalling
Hemostasis
Platelet activation, signaling and aggregation
Gene Ontology Terms (25)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (133)
1 – 10 of 133
FNBP4
Tdark
Novelty: 0.2068824
p_int: 0.999998823
p_ni: 0.000001176
p_wrong: 1e-9
Data Source: BioPlex
FEZF1
Tbio
Family: TF
Novelty: 0.00906866
p_int: 0.999751874
p_ni: 0.00024812
p_wrong: 5e-9
Data Source: BioPlex
HIST1H1B
Tbio
Novelty: 0.00703308
p_int: 0.999426139
p_ni: 0.00056626
p_wrong: 0.0000076
Data Source: BioPlex
HMG20A
Tbio
Family: TF
Novelty: 0.18049861
p_int: 0.998494053
p_ni: 0.001396475
p_wrong: 0.000109472
Data Source: BioPlex
RRP7A
Tdark
Novelty: 0.28985507
p_int: 0.998396853
p_ni: 0.001603147
Data Source: BioPlex
NOL6
Tbio
Novelty: 0.15679443
p_int: 0.997123999
p_ni: 0.002875999
p_wrong: 2e-9
Data Source: BioPlex
HNRNPLL
Tbio
Novelty: 0.0389045
p_int: 0.997121243
p_ni: 0.002878757
Data Source: BioPlex
HIST1H1C
Tbio
Novelty: 0.00937936
p_int: 0.995528461
p_ni: 0.004471539
Data Source: BioPlex
CSNK2A1
Tchem
Family: Kinase
Novelty: 0.00124949
p_int: 0.994670601
p_ni: 0.005329399
Data Source: BioPlex
C18orf25
Tdark
Novelty: 0.45454545
p_int: 0.993936304
p_ni: 0.00605551
p_wrong: 0.000008186
Data Source: BioPlex
Publication Statistics
PubMed Score  92.84

PubMed score by year
PubTator Score  17.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METFFRRHFRGKVPGPGEGQQRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCLLSCGVRAQGS
1-70
SRRRSSTVPPSCNPRFIVDKVLTPQPTTVGAQLLGAPLLLTGLVGMNEEEGVQEDVVAEASSAIQPGTKT
70-140
PGPPPPRGAQPLLPLPRYLRRASSHLLPADAVYDHALWGLHGYYRRLSQRRPSGQHPGPGGRRASGTTAG
140-210
TMLPTRVRPLSRRRQVALRRKAAGPQAWSALLAKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSE
210-280
SATYGEHIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGS
280-350
RNVREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCS
350-420
LGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVN
420-490
PKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKP
490-560
PPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDR
560-630
LPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGM
630-700
DLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERL
700-770
TQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRV
770-840
SMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDAT
840-910
TASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQG
910-980
EELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETC
980-1050
LHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
1050-1117
METFFRRHFRGKVPGPGEGQQRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCLLSCGVRAQGSSRRRSSTVPPSCNPRFIVDKVLTPQPTTVGAQLLGAPLLLTGLVGMNEEEGVQEDVVAEASSAIQPGTKTPGPPPPRGAQPLLPLPRYLRRASSHLLPADAVYDHALWGLHGYYRRLSQRRPSGQHPGPGGRRASGTTAGTMLPTRVRPLSRRRQVALRRKAAGPQAWSALLAKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV