You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PKD2
Polycystin-2

Protein Summary
Description
Component of a heteromeric calcium-permeable ion channel formed by PKD1 and PKD2 that is activated by interaction between PKD1 and a Wnt family member, such as WNT3A and WNT9B (PubMed:27214281). Can also form a functional, homotetrameric ion channel (PubMed:29899465). Functions as a cation channel involved in fluid-flow mechanosensation by the primary cilium in renal epithelium (PubMed:18695040). Functions as outward-rectifying K(+) channel, but is also permeable to Ca(2+), and to a much lesser degree also to Na(+) (PubMed:11854751, PubMed:15692563, PubMed:27071085, PubMed:27991905). May contribute to the release of Ca(2+) stores from the endoplasmic reticulum (PubMed:11854751, PubMed:20881056). Together with TRPV4, forms mechano- and thermosensitive channels in cilium (PubMed:18695040). PKD1 and PKD2 may function through a common signaling pathway that is necessary to maintain the normal, differentiated state of renal tubule cells. Acts as a regulator of cilium length, together with P ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000237596
  • ENSP00000237596
  • ENSG00000118762

Symbol
  • TRPP2
  • PC2
  • PKD4
  • Pc-2
  • APKD2
  • TRPP2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
1
microRNA
0.82
cell type or tissue
0.81
kinase
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 498.17   (req: < 5)
Gene RIFs: 156   (req: <= 3)
Antibodies: 302   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 498.17   (req: >= 5)
Gene RIFs: 156   (req: > 3)
Antibodies: 302   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 75
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
Ca<sup>2+</sup>
no chemical structure image available
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Cargo trafficking to the periciliary membrane (R-HSA-5620920)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo trafficking to the periciliary membrane
Reactome
Cilium Assembly
Reactome
Organelle biogenesis and maintenance
Reactome
VxPx cargo-targeting to cilium
Name
Explore in Pharos
Explore in Source
Cargo trafficking to the periciliary membrane
Cilium Assembly
Organelle biogenesis and maintenance
VxPx cargo-targeting to cilium
Gene Ontology Terms (97)
Items per page:
10
1 – 10 of 21
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (141)
1 – 10 of 141
PKD2L2
Tbio
Family: IC
Novelty: 0.17366136
p_int: 0.999988736
p_ni: 0.000011264
Score: 0.221
Data Source: BioPlex,STRINGDB
COG7
Tbio
Novelty: 0.10023573
p_int: 0.999985303
p_ni: 0.000014697
Data Source: BioPlex
FAM3D
Tbio
Novelty: 0.04514362
p_int: 0.999924722
p_ni: 0.000075278
Score: 0.455
Data Source: BioPlex,STRINGDB
PICK1
Tbio
Novelty: 0.00686801
p_int: 0.999915865
p_ni: 0.000084135
Data Source: BioPlex
ATP6V1D
Tbio
Family: Enzyme
Novelty: 0.03173315
p_int: 0.99955135
p_ni: 0.000448644
p_wrong: 6e-9
Data Source: BioPlex
CYP2J2
Tchem
Novelty: 0.00634057
p_int: 0.999189282
p_ni: 0.000810718
Data Source: BioPlex
BCAS4
Tbio
Novelty: 0.15459088
p_int: 0.999170247
p_ni: 0.000829753
Score: 0.187
Data Source: BioPlex,STRINGDB
PTGIR
Tclin
Family: GPCR
Novelty: 0.00497212
p_int: 0.999120623
p_ni: 0.000879377
Data Source: BioPlex
CRYL1
Tbio
Family: Enzyme
Novelty: 0.02941898
p_int: 0.998234404
p_ni: 0.001765596
Data Source: BioPlex
CHRND
Tclin
Family: IC
Novelty: 0.04863852
p_int: 0.998047563
p_ni: 0.001952437
Score: 0.229
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  498.17

PubMed score by year
PubTator Score  587.15

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAG
1-70
AAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRG
70-140
LGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESS
140-210
TNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFW
210-280
KFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSV
280-350
SSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR
350-420
ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVE
420-490
EILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNN
490-560
IAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQ
560-630
ECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMEL
630-700
SDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQEL
700-770
TEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ
770-840
VLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVR
840-910
EELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV
910-968
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV