You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HDAC1
Histone deacetylase 1

Protein Summary
Description
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/ ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373548
  • ENSP00000362649
  • ENSG00000116478

Symbol
  • RPD3L1
  • HD1
  • RPD3
  • KDAC1
  • GON-10
  • RPD3L1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
hub protein
1
interacting protein
1
molecular function
1
protein complex
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1038.61   (req: < 5)
Gene RIFs: 326   (req: <= 3)
Antibodies: 1453   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1038.61   (req: >= 5)
Gene RIFs: 326   (req: > 3)
Antibodies: 1453   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 58
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2451
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Active Ligands (2451)
1 – 10 of 2451
CHEMBL99
chemical structure image
CHEMBL27759
chemical structure image
CHEMBL408513
chemical structure image
CHEMBL356066
chemical structure image
CHEMBL2018302,CHEMBL3770936
chemical structure image
CHEMBL1213490
chemical structure image
CHEMBL272980
chemical structure image
CHEMBL598797
chemical structure image
CHEMBL1213492
chemical structure image
CHEMBL1851943,CHEMBL3215861
chemical structure image
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (140)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 76
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Chromatin modifying enzymes
Chromatin organization
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Gene Ontology Terms (72)
Items per page:
10
1 – 10 of 23
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (878)
1 – 10 of 878
DNTTIP1
Tbio
Family: Enzyme
Novelty: 0.26825633
p_int: 1
Score: 0.948
Data Source: BioPlex,STRINGDB
SINHCAF
Tdark
Novelty: 0.25139665
p_int: 1
Score: 0.941
Data Source: BioPlex,STRINGDB
ELMSAN1
Tdark
Novelty: 7.91666667
p_int: 1
Score: 0.719
Data Source: BioPlex,STRINGDB
ZNF219
Tbio
Family: TF
Novelty: 0.25418994
p_int: 1
Score: 0.606
Data Source: BioPlex,STRINGDB
MIER2
Tbio
Novelty: 1.42857143
p_int: 1
Score: 0.458
Data Source: BioPlex,STRINGDB
GATAD2B
Tbio
Family: TF
Novelty: 0.07240695
p_int: 0.999999999
p_ni: 1e-9
Score: 0.983
Data Source: BioPlex,STRINGDB
HMG20A
Tbio
Family: TF
Novelty: 0.18049861
p_int: 0.999999998
p_ni: 2e-9
Score: 0.394
Data Source: BioPlex,STRINGDB
ZNF217
Tbio
Family: TF
Novelty: 0.01609131
p_int: 0.999999993
p_ni: 4e-9
p_wrong: 4e-9
Score: 0.965
Data Source: BioPlex,STRINGDB
HMG20B
Tbio
Family: TF
Novelty: 0.08820104
p_int: 0.999999986
p_ni: 1.4e-8
Score: 0.981
Data Source: BioPlex,STRINGDB
RREB1
Tbio
Family: TF
Novelty: 0.01945608
p_int: 0.999999986
p_ni: 3e-9
p_wrong: 1.1e-8
Score: 0.406
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1038.61

PubMed score by year
PubTator Score  1010.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSD
1-70
DYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLH
70-140
HAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD
140-210
LRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKG
210-280
HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNM
280-350
TNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
350-420
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
420-482
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA