Protein Classes
Protein Summary
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/ ...more
- ENST00000373548
- ENSP00000362649
- ENSG00000116478
- RPD3L1
- HD1
- RPD3
- KDAC1
- GON-10
- RPD3L1
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
co-expressed gene | 1 | ||
hub protein | 1 | ||
interacting protein | 1 | ||
molecular function | 1 | ||
protein complex | 1 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1038.61 (req: < 5)
Gene RIFs: 326 (req: <= 3)
Antibodies: 1453 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1038.61 (req: >= 5)
Gene RIFs: 326 (req: > 3)
Antibodies: 1453 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 58
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 2451
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 6
Approved Drugs (6)
1 – 6 of 6
Active Ligands (2451)
1 – 10 of 2451
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (140)
Reactome (76)
KEGG (14)
PathwayCommons (27)
WikiPathways (23)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 76
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Cell Cycle | ||||
Reactome | Cell Cycle, Mitotic | ||||
Reactome | Chromatin modifying enzymes | ||||
Reactome | Chromatin organization | ||||
Reactome | Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Cell Cycle | ||||
Cell Cycle, Mitotic | ||||
Chromatin modifying enzymes | ||||
Chromatin organization | ||||
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | ||||
Gene Ontology Terms (72)
Functions (23)
Components (14)
Processes (35)
Items per page:
10
1 – 10 of 23
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | MGI | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | ParkinsonsUK-UCL | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Protein-Protein Interactions (878)
1 – 10 of 878
DNTTIP1
Family: Enzyme
Novelty: 0.26825633
p_int: 1
Score: 0.948
Data Source: BioPlex,STRINGDB
SINHCAF
Novelty: 0.25139665
p_int: 1
Score: 0.941
Data Source: BioPlex,STRINGDB
ELMSAN1
Novelty: 7.91666667
p_int: 1
Score: 0.719
Data Source: BioPlex,STRINGDB
ZNF219
Family: TF
Novelty: 0.25418994
p_int: 1
Score: 0.606
Data Source: BioPlex,STRINGDB
MIER2
Novelty: 1.42857143
p_int: 1
Score: 0.458
Data Source: BioPlex,STRINGDB
GATAD2B
Family: TF
Novelty: 0.07240695
p_int: 0.999999999
p_ni: 1e-9
Score: 0.983
Data Source: BioPlex,STRINGDB
HMG20A
Family: TF
Novelty: 0.18049861
p_int: 0.999999998
p_ni: 2e-9
Score: 0.394
Data Source: BioPlex,STRINGDB
ZNF217
Family: TF
Novelty: 0.01609131
p_int: 0.999999993
p_ni: 4e-9
p_wrong: 4e-9
Score: 0.965
Data Source: BioPlex,STRINGDB
HMG20B
Family: TF
Novelty: 0.08820104
p_int: 0.999999986
p_ni: 1.4e-8
Score: 0.981
Data Source: BioPlex,STRINGDB
RREB1
Family: TF
Novelty: 0.01945608
p_int: 0.999999986
p_ni: 3e-9
p_wrong: 1.1e-8
Score: 0.406
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 1038.61
PubMed score by year
PubTator Score 1010.44
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSD
1-70
DYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLH
70-140
HAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD
140-210
LRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKG
210-280
HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNM
280-350
TNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
350-420
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
420-482
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Find similar targets by: