You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NFATC2
Nuclear factor of activated T-cells, cytoplasmic 2

Protein Summary
Description
Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Apr 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371564
  • ENSP00000360619
  • ENSG00000101096
  • ENST00000396009
  • ENSP00000379330
  • ENST00000414705
  • ENSP00000396471
  • ENST00000609507
  • ENSP00000477342
  • ENST00000609943
  • ENSP00000477370
  • ENST00000610033
  • ENSP00000477142

Symbol
  • NFAT1
  • NFATP
  • NFAT1
  • NFATP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.94
biological process
0.87
protein domain
0.85
molecular function
0.84
transcription factor binding site profile
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 285.5   (req: < 5)
Gene RIFs: 120   (req: <= 3)
Antibodies: 479   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 285.5   (req: >= 5)
Gene RIFs: 120   (req: > 3)
Antibodies: 479   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (69)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
C-type lectin receptors (CLRs)
Reactome
CLEC7A (Dectin-1) induces NFAT activation
Reactome
CLEC7A (Dectin-1) signaling
Reactome
Calcineurin activates NFAT
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
C-type lectin receptors (CLRs)
CLEC7A (Dectin-1) induces NFAT activation
CLEC7A (Dectin-1) signaling
Calcineurin activates NFAT
Gene Ontology Terms (32)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (144)
1 – 10 of 144
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.997
Data Source: STRINGDB
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.996
Data Source: Reactome,STRINGDB
IL2
Tchem
Novelty: 0.00004362
Score: 0.987
Data Source: STRINGDB
MAPK8
Tchem
Family: Kinase
Novelty: 0.00013952
Score: 0.984
Data Source: STRINGDB
IRF4
Tbio
Family: TF
Novelty: 0.00259198
Score: 0.98
Data Source: STRINGDB
PPP3R1
Tbio
Novelty: 0.00213192
Score: 0.972
Data Source: Reactome,STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
Score: 0.969
Data Source: STRINGDB
PPP3CA
Tchem
Family: Enzyme
Novelty: 0.00238194
Score: 0.963
Data Source: Reactome,STRINGDB
PPP3CB
Tbio
Family: Enzyme
Novelty: 0.02520885
Score: 0.959
Data Source: Reactome,STRINGDB
CABIN1
Tbio
Novelty: 0.00039531
Score: 0.959
Data Source: STRINGDB
Publication Statistics
PubMed Score  285.50

PubMed score by year
PubTator Score  215.95

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLK
1-70
PYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP
70-140
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPA
140-210
HYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPS
210-280
SHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE
280-350
FLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
350-420
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYE
420-490
KIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL
490-560
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDK
560-630
DKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG
630-700
GLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPAL
700-770
MAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
770-840
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE
840-910
IIRKEFSGPPARNQT
910-925
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT