You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TMED1
Transmembrane emp24 domain-containing protein 1

Protein Summary
Description
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. May act as a cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and may be involved in vesicle coat formation at the cytoplasmic side. This gene belongs to the TMED (transmembrane emp24 domain-containing) protein family, which is involved in the vesicular trafficking of proteins. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity. This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000214869
  • ENSP00000214869
  • ENSG00000099203

Symbol
  • IL1RL1L
  • IL1RL1LG
  • Tp24
  • p24g1
  • Il1rl1l
  • IL1RL1LG
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
histone modification site profile
0.95
interacting protein
0.82
transcription factor binding site profile
0.81
cell type or tissue
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.88   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 159   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.88   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 159   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (14)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (25)
1 – 10 of 25
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.99386343
p_ni: 0.00613657
Score: 0.153
Data Source: BioPlex,STRINGDB
TMED2
Tbio
Novelty: 0.0532436
p_int: 0.992742949
p_ni: 0.00725705
p_wrong: 1e-9
Score: 0.553
Data Source: BioPlex,STRINGDB
FGF3
Tbio
Novelty: 0.00555787
p_int: 0.971765116
p_ni: 0.028234884
Score: 0.177
Data Source: BioPlex,STRINGDB
TMED10
Tbio
Novelty: 0.0307377
p_int: 0.970868384
p_ni: 0.029131616
Score: 0.941
Data Source: BioPlex,STRINGDB
CDK5RAP3
Tbio
Novelty: 0.04407983
p_int: 0.963967459
p_ni: 0.036032541
Score: 0.21
Data Source: BioPlex,STRINGDB
JPH4
Tbio
Novelty: 0.02095843
p_int: 0.769644162
p_ni: 0.230355838
Data Source: BioPlex
TMED9
Tdark
Novelty: 0.48137536
Score: 0.822
Data Source: STRINGDB
TMED4
Tbio
Novelty: 0.01545983
Score: 0.804
Data Source: STRINGDB
IL1RL1
Tbio
Novelty: 0.00821961
Score: 0.759
Data Source: STRINGDB
CYB5R4
Tbio
Family: Enzyme
Novelty: 0.07168595
Score: 0.578
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.88

PubMed score by year
PubTator Score  2.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV
1-70
DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA
70-140
VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL
140-210
QVCTLKRFFQDKRPVPT
210-227
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRPVPT