You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PDCL
Phosducin-like protein

Protein Summary
Description
Acts as a positive regulator of hedgehog signaling and regulates ciliary function. Isoform 1: Functions as a co-chaperone for CCT in the assembly of heterotrimeric G protein complexes, facilitates the assembly of both Gbeta-Ggamma and RGS-Gbeta5 heterodimers. Isoform 2: Acts as a negative regulator of heterotrimeric G proteins assembly by trapping the preloaded G beta subunits inside the CCT chaperonin. Phosducin-like protein is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in retina and pineal gland. Both phosducin-like protein and phosphoducin have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259467
  • ENSP00000259467
  • ENSG00000136940

Symbol
  • PHLOP1
  • PhLP1
  • PhLP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.83
disease perturbation
0.62
protein domain
0.58
cell line
0.54
histone modification site profile
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 837.39   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 837.39   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Chaperonin-mediated protein folding (R-HSA-390466)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chaperonin-mediated protein folding
Reactome
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Reactome
Metabolism of proteins
Reactome
Protein folding
Name
Explore in Pharos
Explore in Source
Chaperonin-mediated protein folding
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Metabolism of proteins
Protein folding
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (102)
1 – 10 of 102
GNB5
Tbio
Novelty: 0.01077999
p_int: 0.999950183
p_ni: 0.000049817
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
p_int: 0.999827779
p_ni: 0.000172221
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
GNGT1
Tbio
Novelty: 0.03653174
p_int: 0.99972663
p_ni: 0.00027337
Score: 0.97
Data Source: BioPlex,STRINGDB
KLHDC8A
Tdark
p_int: 0.990918649
p_ni: 0.009081351
p_wrong: 1e-9
Score: 0.6
Data Source: BioPlex,STRINGDB
NF2
Tbio
Novelty: 0.00064393
p_int: 0.980176947
p_ni: 0.019823053
Score: 0.212
Data Source: BioPlex,STRINGDB
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.974211905
p_ni: 0.025788095
Score: 0.917
Data Source: BioPlex,Reactome,STRINGDB
CCT2
Tbio
Novelty: 0.03021537
p_int: 0.943387503
p_ni: 0.056611156
p_wrong: 0.000001342
Score: 0.918
Data Source: BioPlex,STRINGDB
CCT7
Tbio
Novelty: 0.03353089
p_int: 0.94248499
p_ni: 0.057515009
p_wrong: 1e-9
Score: 0.959
Data Source: BioPlex,STRINGDB
CCT3
Tbio
Novelty: 0.00555442
p_int: 0.936137821
p_ni: 0.063862179
Score: 0.961
Data Source: BioPlex,STRINGDB
TUBG2
Tbio
Novelty: 0.23300971
p_int: 0.934436408
p_ni: 0.065563587
p_wrong: 5e-9
Score: 0.489
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  837.39

PubMed score by year
PubTator Score  20.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFK
1-70
QLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQY
70-140
RKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYP
140-210
AVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVL
210-280
VLTSVRNSATCHSEDSDLEID
280-301
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEID