You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PDE3B
cGMP-inhibited 3',5'-cyclic phosphodiesterase B

Protein Summary
Description
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. May play a role in fat metabolism. Regulates cAMP binding of RAPGEF3. Through simultaneous binding to RAPGEF3 and PIK3R6 assembles a signaling complex in which the PI3K gamma complex is activated by RAPGEF3 and which is involved in angiogenesis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000282096
  • ENSP00000282096
  • ENSG00000152270
  • ENST00000455098
  • ENSP00000388644

Symbol
  • HcGIP1
  • cGIPDE1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.91
microRNA
0.82
kinase perturbation
0.76
disease perturbation
0.74
PubMedID
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.68   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 182   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.68   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 182   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 68
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 8
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (150)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
FLT3 Signaling
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
IGF1R signaling cascade
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
FLT3 Signaling
G alpha (s) signalling events
GPCR downstream signalling
IGF1R signaling cascade
Gene Ontology Terms (20)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (169)
1 – 10 of 169
TEX28
Tdark
Novelty: 0.18072289
p_int: 0.999087928
p_ni: 0.000912072
Data Source: BioPlex
ZNRF4
Tbio
Novelty: 0.18181818
p_int: 0.997668134
p_ni: 0.002331866
Data Source: BioPlex
LRRTM1
Tbio
Novelty: 0.05800638
p_int: 0.984572714
p_ni: 0.015427285
p_wrong: 1e-9
Score: 0.164
Data Source: BioPlex,STRINGDB
PCDHAC2
Tdark
Novelty: 0.41763341
p_int: 0.950408126
p_ni: 0.049591874
Data Source: BioPlex
HLA-DRB1
Tbio
Novelty: 0.00375288
p_int: 0.926139805
p_ni: 0.073860195
Data Source: BioPlex
IL17RC
Tclin
Novelty: 0.02676926
p_int: 0.925918755
p_ni: 0.074081245
Data Source: BioPlex
GRIN2A
Tclin
Family: IC
Novelty: 0.00075253
p_int: 0.923638178
p_ni: 0.07636182
p_wrong: 1e-9
Data Source: BioPlex
KCNS3
Tclin
Family: IC
Novelty: 0.08293831
p_int: 0.902823212
p_ni: 0.097176788
Data Source: BioPlex
TEX264
Tdark
Novelty: 0.6271777
p_int: 0.900196295
p_ni: 0.099803705
Data Source: BioPlex
FAM189B
Tbio
Novelty: 0.62780269
p_int: 0.889196748
p_ni: 0.110803252
Score: 0.198
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  95.68

PubMed score by year
PubTator Score  258.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR
1-70
RCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK
70-140
RGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL
140-210
AHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS
210-280
AAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNG
280-350
VDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
350-420
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK
420-490
QRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN
490-560
TPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS
560-630
RKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM
630-700
YTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG
700-770
NETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
770-840
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKAN
840-910
DVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRS
910-980
SPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR
980-1050
RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE
1050-1112
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE