You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SGCG
Gamma-sarcoglycan

Protein Summary
Description
Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000218867
  • ENSP00000218867
  • ENSG00000102683

Symbol
  • A4
  • MAM
  • DMDA
  • SCG3
  • 35DAG
  • DAGA4
  • DMDA1
  • LGMD2C
  • LGMDR5
  • SCARMD2
  • gamma-SG
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
0.91
gene perturbation
0.9
trait
0.86
tissue sample
0.62
small molecule perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 172.25   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 172.25   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Dilated cardiomyopathy (DCM)
KEGG
Viral myocarditis
KEGG
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
KEGG
Hypertrophic cardiomyopathy (HCM)
Name
Explore in Pharos
Explore in Source
Dilated cardiomyopathy (DCM)
Viral myocarditis
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Hypertrophic cardiomyopathy (HCM)
Gene Ontology Terms (9)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (58)
1 – 10 of 58
SGCA
Tbio
Novelty: 0.00500833
Score: 0.948
Data Source: STRINGDB
DMD
Tclin
Novelty: 0.00029078
Score: 0.93
Data Source: STRINGDB
SSPN
Tbio
Novelty: 0.02254936
Score: 0.915
Data Source: STRINGDB
DAG1
Tbio
Family: Enzyme
Novelty: 0.00185637
Score: 0.869
Data Source: STRINGDB
SGCE
Tbio
Novelty: 0.00599539
Score: 0.849
Data Source: STRINGDB
SGCB
Tbio
Novelty: 0.0009261
Score: 0.837
Data Source: STRINGDB
SNTB1
Tbio
Novelty: 0.07544233
Score: 0.815
Data Source: STRINGDB
UTRN
Tbio
Novelty: 0.00225431
Score: 0.8
Data Source: STRINGDB
CAV3
Tbio
Novelty: 0.00250765
Score: 0.79
Data Source: STRINGDB
SNTA1
Tbio
Novelty: 0.03034237
Score: 0.782
Data Source: STRINGDB
Publication Statistics
PubMed Score  172.25

PubMed score by year
PubTator Score  301.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGH
1-70
LCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQF
70-140
QINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVH
140-210
IQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS
210-280
TTCQEHNHICL
280-291
MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHNHICL