You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NR5A1
Steroidogenic factor 1

Protein Summary
Description
Transcriptional activator. Essential for sexual differentiation and formation of the primary steroidogenic tissues (PubMed:27378692). Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1 (PubMed:27378692). The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity. Binds phosphatidylcholine (By similarity). Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a mono ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373588
  • ENSP00000362690
  • ENSG00000136931

Symbol
  • AD4BP
  • FTZF1
  • SF1
  • ELP
  • SF1
  • FTZ1
  • POF7
  • SF-1
  • AD4BP
  • FTZF1
  • SPGF8
  • SRXX4
  • SRXY3
  • hSF-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
hub protein
0.9
protein domain
0.85
biological process
0.84
biological term
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 937.38   (req: < 5)
Gene RIFs: 175   (req: <= 3)
Antibodies: 377   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 937.38   (req: >= 5)
Gene RIFs: 175   (req: > 3)
Antibodies: 377   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 35
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 5
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism of proteins
Reactome
Nuclear Receptor transcription pathway
Name
Explore in Pharos
Explore in Source
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism of proteins
Nuclear Receptor transcription pathway
Gene Ontology Terms (38)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (150)
1 – 10 of 150
NR0B1
Tbio
Family: NR
Novelty: 0.00171069
Score: 0.983
Data Source: STRINGDB
UBE2I
Tbio
Novelty: 0.00316288
Score: 0.967
Data Source: Reactome,STRINGDB
PIAS1
Tbio
Family: TF
Novelty: 0.01153358
Score: 0.942
Data Source: STRINGDB
SUMO1
Tbio
Novelty: 0.00169202
Score: 0.937
Data Source: Reactome,STRINGDB
FOXL2
Tbio
Family: TF
Novelty: 0.00136796
Score: 0.936
Data Source: STRINGDB
SUMO2
Tbio
Novelty: 0.00437464
Score: 0.932
Data Source: Reactome,STRINGDB
NRIP1
Tbio
Novelty: 0.00621822
Score: 0.912
Data Source: STRINGDB
PIAS3
Tbio
Family: TF
Novelty: 0.01507171
Score: 0.902
Data Source: STRINGDB
MED1
Tbio
Family: Enzyme
Novelty: 0.01259825
Score: 0.9
Data Source: STRINGDB
SOX9
Tbio
Family: TF
Novelty: 0.00058844
Score: 0.891
Data Source: STRINGDB
Publication Statistics
PubMed Score  937.38

PubMed score by year
PubTator Score  607.72

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRF
1-70
QKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVL
70-140
PPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLP
140-210
YGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
210-280
RRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLR
280-350
AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
350-420
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
420-461
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT