You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IL15RA
Interleukin-15 receptor subunit alpha

Protein Summary
Description
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK. This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379971
  • ENSP00000369306
  • ENSG00000134470
  • ENST00000379977
  • ENSP00000369312
  • ENST00000397250
  • ENSP00000380422
  • ENST00000397255
  • ENSP00000380426
  • ENST00000525219
  • ENSP00000431529
  • ENST00000528354
  • ENSP00000435454
  • ENST00000530685
  • ENSP00000435995

Symbol
  • CD215
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
PubMedID
0.95
biological term
0.7
disease
0.66
transcription factor binding site profile
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.47   (req: < 5)
Gene RIFs: 66   (req: <= 3)
Antibodies: 426   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.47   (req: >= 5)
Gene RIFs: 66   (req: > 3)
Antibodies: 426   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (132)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-15 signaling
Reactome
Interleukin-2 family signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-15 signaling
Interleukin-2 family signaling
Signaling by Interleukins
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (35)
1 – 10 of 35
IL15
Tbio
Novelty: 0.00081119
Score: 0.997
Data Source: Reactome,STRINGDB
IL2RG
Tclin
Novelty: 0.00155443
Score: 0.994
Data Source: Reactome,STRINGDB
IL2RB
Tclin
Novelty: 0.00753505
Score: 0.993
Data Source: Reactome,STRINGDB
JAK3
Tclin
Family: Kinase
Novelty: 0.00219647
Score: 0.935
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.933
Data Source: STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.927
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.922
Data Source: STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.922
Data Source: Reactome,STRINGDB
SHC1
Tchem
Novelty: 0.00113167
Score: 0.902
Data Source: STRINGDB
SOS1
Tbio
Novelty: 0.00388471
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.47

PubMed score by year
PubTator Score  117.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTS
1-70
SLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTA
70-140
ATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAIST
140-210
STVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL
210-267
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL