You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SRSF9
Serine/arginine-rich splicing factor 9

Protein Summary
Description
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10. The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. [provided by RefSeq, Sep 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229390
  • ENSP00000229390
  • ENSG00000111786

Symbol
  • SFRS9
  • SRP30C
  • SFRS9
  • SRp30c
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
disease perturbation
1
interacting protein
0.99
kinase perturbation
0.99
ligand (protein) perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.73   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 223   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.73   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 223   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
RNA Polymerase II Transcription
Reactome
RNA Polymerase II Transcription Termination
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
RNA Polymerase II Transcription
RNA Polymerase II Transcription Termination
Gene Ontology Terms (15)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (305)
1 – 10 of 305
SNIP1
Tbio
Novelty: 0.0303933
p_int: 0.809960976
p_ni: 0.190039024
Score: 0.236
Data Source: BioPlex,STRINGDB
NKAPD1
Tdark
Novelty: 2.25
p_int: 0.775216008
p_ni: 0.224783992
Score: 0.173
Data Source: BioPlex,STRINGDB
SRSF7
Tbio
Novelty: 0.05536211
Score: 0.999
Data Source: STRINGDB
SRSF1
Tbio
Novelty: 0.00119334
Score: 0.998
Data Source: STRINGDB
TRA2B
Tbio
Novelty: 0.02179789
Score: 0.998
Data Source: STRINGDB
SRSF2
Tbio
Novelty: 0.00273135
Score: 0.997
Data Source: STRINGDB
SRSF6
Tbio
Novelty: 0.00525642
Score: 0.993
Data Source: STRINGDB
SRSF3
Tbio
Novelty: 0.0126411
Score: 0.992
Data Source: STRINGDB
RBMX
Tbio
Novelty: 0.02400029
Score: 0.989
Data Source: STRINGDB
SNRNP70
Tbio
Novelty: 0.00199593
Score: 0.987
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.73

PubMed score by year
PubTator Score  18.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIY
1-70
GRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYA
70-140
DVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRG
140-210
SPHYFSPFRPY
210-221
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY