You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAP2K5
Dual specificity mitogen-activated protein kinase kinase 5

Protein Summary
Description
Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac development and angiogenesis. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. [provided by RefSeq, May 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000178640
  • ENSP00000178640
  • ENSG00000137764
  • ENST00000354498
  • ENSP00000346493
  • ENST00000395476
  • ENSP00000378859

Symbol
  • MEK5
  • MKK5
  • PRKMK5
  • MEK5
  • MAPKK5
  • PRKMK5
  • HsT17454
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
disease perturbation
0.96
molecular function
0.96
drug perturbation
0.87
histone modification site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.85   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 519   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.85   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 519   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 9
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (37)
Signal Transduction (R-HSA-162582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Signal Transduction
Reactome
Signaling by NTRK1 (TRKA)
Reactome
Signaling by NTRKs
Reactome
Signaling by Receptor Tyrosine Kinases
Reactome
Signalling to ERK5
Name
Explore in Pharos
Explore in Source
Signal Transduction
Signaling by NTRK1 (TRKA)
Signaling by NTRKs
Signaling by Receptor Tyrosine Kinases
Signalling to ERK5
Gene Ontology Terms (32)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (117)
1 – 10 of 117
MAPK7
Tchem
Family: Kinase
Novelty: 0.00301243
p_int: 1
Score: 0.979
Data Source: BioPlex,Reactome,STRINGDB
MAP3K2
Tchem
Family: Kinase
Novelty: 0.02884185
p_int: 0.999999982
p_wrong: 1.8e-8
Score: 0.998
Data Source: BioPlex,STRINGDB
MAP3K3
Tchem
Family: Kinase
Novelty: 0.01604934
p_int: 0.999953191
p_ni: 0.000046808
p_wrong: 1e-9
Score: 0.989
Data Source: BioPlex,STRINGDB
TRAF7
Tbio
Family: Enzyme
Novelty: 0.05310289
p_int: 0.973004833
p_ni: 0.026995167
Score: 0.257
Data Source: BioPlex,STRINGDB
C10orf88
Tdark
Novelty: 0.68515498
p_int: 0.970569854
p_ni: 0.029430146
Data Source: BioPlex
CDC37
Tbio
Novelty: 0.0735786
p_int: 0.76354397
p_ni: 0.23645603
Score: 0.381
Data Source: BioPlex,STRINGDB
MAP3K1
Tchem
Family: Kinase
Novelty: 0.00673188
Score: 0.955
Data Source: STRINGDB
BDNF
Tbio
Novelty: 0.00008738
Score: 0.932
Data Source: STRINGDB
NTRK1
Tclin
Family: Kinase
Novelty: 0.0004431
Score: 0.925
Data Source: STRINGDB
NGF
Tchem
Novelty: 0.00009278
Score: 0.923
Data Source: STRINGDB
Publication Statistics
PubMed Score  96.85

PubMed score by year
PubTator Score  69.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRI
1-70
TVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSL
70-140
PSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIM
140-210
SELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL
210-280
HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA
280-350
LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
350-420
QFNDGNAAVVSMWVCRALEERRSQQGPP
420-448
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP