You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RPA4
Replication protein A 30 kDa subunit

Protein Summary
Description
As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange. This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373040
  • ENSP00000362131
  • ENSG00000204086

Symbol
  • HSU24186
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
cell type or tissue
0.56
tissue
0.51
tissue sample
0.51
cellular component
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.69   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 171   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.69   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 171   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Activation of the pre-replicative complex (R-HSA-68962)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the pre-replicative complex
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
DNA Replication
Reactome
DNA Replication Pre-Initiation
Name
Explore in Pharos
Explore in Source
Activation of the pre-replicative complex
Cell Cycle
Cell Cycle, Mitotic
DNA Replication
DNA Replication Pre-Initiation
Gene Ontology Terms (29)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (107)
1 – 10 of 107
HMCES
Tbio
Family: Enzyme
Novelty: 0.03694581
p_int: 0.999426016
p_ni: 0.000573984
Score: 0.261
Data Source: BioPlex,STRINGDB
XPC
Tbio
Novelty: 0.00902281
p_int: 0.999211292
p_ni: 0.000788708
Score: 0.798
Data Source: BioPlex,STRINGDB
PARP2
Tclin
Family: Enzyme
Novelty: 0.00798241
p_int: 0.990337022
p_ni: 0.009662975
p_wrong: 3e-9
Score: 0.462
Data Source: BioPlex,STRINGDB
RPA1
Tchem
Novelty: 0.00309278
p_int: 0.990243727
p_ni: 0.009756273
Score: 0.985
Data Source: BioPlex,Reactome,STRINGDB
RPA3
Tbio
Novelty: 0.01280383
p_int: 0.976837784
p_ni: 0.023162216
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
SUPT16H
Tbio
Family: Enzyme
Novelty: 0.01332412
p_int: 0.939132236
p_ni: 0.060867764
Score: 0.395
Data Source: BioPlex,STRINGDB
PARP1
Tclin
Family: Enzyme
Novelty: 0.00042675
p_int: 0.912000067
p_ni: 0.087999933
Score: 0.609
Data Source: BioPlex,STRINGDB
PRIM1
Tbio
Family: Enzyme
Novelty: 0.14581277
Score: 0.971
Data Source: STRINGDB
MCM7
Tbio
Novelty: 0.00227245
Score: 0.971
Data Source: STRINGDB
MCM5
Tbio
Novelty: 0.0110685
Score: 0.97
Data Source: STRINGDB
Publication Statistics
PubMed Score  21.69

PubMed score by year
PubTator Score  9.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII
1-70
VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL
70-140
EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH
140-210
ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
210-261
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD