You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EIF2B5
Translation initiation factor eIF-2B subunit epsilon

Protein Summary
Description
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000273783
  • ENSP00000273783
  • ENSG00000145191
  • ENST00000648915
  • ENSP00000497160

Symbol
  • EIF2BE
  • CLE
  • CACH
  • LVWM
  • EIF-2B
  • EIF2Bepsilon
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.96
disease perturbation
0.93
transcription factor binding site profile
0.89
kinase perturbation
0.88
histone modification site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 89.93   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 151   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 89.93   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 151   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Cap-dependent Translation Initiation (R-HSA-72737)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cap-dependent Translation Initiation
Reactome
Eukaryotic Translation Initiation
Reactome
Metabolism of proteins
Reactome
Recycling of eIF2:GDP
Reactome
Translation
Name
Explore in Pharos
Explore in Source
Cap-dependent Translation Initiation
Eukaryotic Translation Initiation
Metabolism of proteins
Recycling of eIF2:GDP
Translation
Protein-Protein Interactions (137)
1 – 10 of 137
CAMSAP2
Tbio
Novelty: 0.12833512
p_int: 0.999999975
p_ni: 2.5e-8
Data Source: BioPlex
INCENP
Tbio
Novelty: 0.00902257
p_int: 0.999999878
p_ni: 1.22e-7
Data Source: BioPlex
EIF2B3
Tbio
Novelty: 0.05806987
p_int: 0.999997689
p_ni: 0.000002311
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF2B2
Tbio
Novelty: 0.04147594
p_int: 0.999996886
p_ni: 0.000003112
p_wrong: 2e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
EIF2B4
Tbio
Novelty: 0.07295839
p_int: 0.999996792
p_ni: 0.000003208
Score: 0.999
Data Source: BioPlex,STRINGDB
ASH1L
Tbio
Family: Epigenetic
Novelty: 0.04136435
p_int: 0.99999075
p_ni: 0.00000925
Data Source: BioPlex
MIS18BP1
Tbio
Novelty: 0.07604563
p_int: 0.999968409
p_ni: 0.000030905
p_wrong: 6.86e-7
Data Source: BioPlex
PLD1
Tchem
Family: Enzyme
Novelty: 0.00756297
p_int: 0.999958735
p_ni: 0.000041264
Data Source: BioPlex
TTC3
Tbio
Family: Enzyme
Novelty: 0.04095208
p_int: 0.999947724
p_ni: 0.000051271
p_wrong: 0.000001005
Data Source: BioPlex
GPR183
Tchem
Family: GPCR
Novelty: 0.021257
p_int: 0.999858056
p_ni: 0.000141944
Score: 0.264
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  89.93

PubMed score by year
PubTator Score  53.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPL
1-70
ANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDA
70-140
KALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTN
140-210
RVLHFQKTQGLRRFAFPLSLFQGSSDGVEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNE
210-280
EILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSL
280-350
GHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
350-420
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGA
420-490
AGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGT
490-560
LQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSP
560-630
VFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKN
630-700
QQLQRFIQWLKEAEEESSEDD
700-721
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSEDD