You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NR1H3
Oxysterols receptor LXR-alpha

Protein Summary
Description
Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:19481530, PubMed:25661920). Interaction with retinoic acid receptor (RXR) shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES (By similarity). LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides (By similarity). Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8 (PubMed:19481530). Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity). The protein encoded by this gene belongs to the NR1 subfamily of the nuclear receptor superfamily. The NR1 family members are key regulators of macrophage function, controlling transcriptional programs involve ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000395397
  • ENSP00000378793
  • ENSG00000025434
  • ENST00000405853
  • ENSP00000384745
  • ENST00000407404
  • ENSP00000385801
  • ENST00000441012
  • ENSP00000387946
  • ENST00000467728
  • ENSP00000420656

Symbol
  • LXRA
  • LXRA
  • LXR-a
  • RLD-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.98
disease perturbation
0.87
transcription factor binding site profile
0.87
cell type or tissue
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 128.39   (req: < 5)
Gene RIFs: 228   (req: <= 3)
Antibodies: 530   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 128.39   (req: >= 5)
Gene RIFs: 228   (req: > 3)
Antibodies: 530   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 48
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 261
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism
Metabolism of lipids
Metabolism of proteins
Gene Ontology Terms (54)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
BHF-UCL
Protein-Protein Interactions (118)
1 – 10 of 118
DDI2
Tdark
Novelty: 0.14978602
p_int: 0.998609285
p_ni: 0.001390715
Score: 0.528
Data Source: BioPlex,STRINGDB
PDE8A
Tclin
Family: Enzyme
Novelty: 0.0402195
p_int: 0.974731562
p_ni: 0.000048516
p_wrong: 0.025219921
Score: 0.359
Data Source: BioPlex,STRINGDB
STRN4
Tbio
Novelty: 0.14202711
p_int: 0.972102344
p_ni: 0.027897651
p_wrong: 5e-9
Score: 0.201
Data Source: BioPlex,STRINGDB
STRN
Tbio
Novelty: 0.01561194
p_int: 0.959271937
p_ni: 0.040728063
Score: 0.234
Data Source: BioPlex,STRINGDB
STRN3
Tbio
Novelty: 0.15807301
p_int: 0.770491535
p_ni: 0.229508465
Score: 0.201
Data Source: BioPlex,STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.993
Data Source: Reactome,STRINGDB
NCOR1
Tchem
Family: TF
Novelty: 0.00288779
Score: 0.988
Data Source: Reactome,STRINGDB
NCOR2
Tchem
Family: TF
Novelty: 0.00127046
Score: 0.987
Data Source: Reactome,STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.986
Data Source: Reactome,STRINGDB
ABCA1
Tclin
Family: Transporter
Novelty: 0.00066145
Score: 0.985
Data Source: STRINGDB
Publication Statistics
PubMed Score  128.39

PubMed score by year
PubTator Score  347.97

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA
1-70
EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC
70-140
PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ
140-210
LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ
210-280
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ
280-350
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
350-420
HSEQVFALRLQDKKLPPLLSEIWDVHE
420-447
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE