You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KLF10
Krueppel-like factor 10

Protein Summary
Description
Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis (By similarity). May play a role in the cell cycle regulation. This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285407
  • ENSP00000285407
  • ENSG00000155090
  • ENST00000395884
  • ENSP00000379222

Symbol
  • TIEG
  • TIEG1
  • EGRA
  • TIEG
  • TIEG1
  • EGR-alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.99
transcription factor binding site profile
0.96
disease perturbation
0.93
biological process
0.9
small molecule perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 114.88   (req: < 5)
Gene RIFs: 39   (req: <= 3)
Antibodies: 272   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 114.88   (req: >= 5)
Gene RIFs: 39   (req: > 3)
Antibodies: 272   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (23)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (33)
1 – 10 of 33
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.795
Data Source: STRINGDB
KDM5B
Tchem
Family: TF; Epigenetic
Novelty: 0.00508605
Score: 0.751
Data Source: STRINGDB
SIN3A
Tbio
Novelty: 0.01059111
Score: 0.659
Data Source: STRINGDB
TYK2
Tclin
Family: Kinase
Novelty: 0.00331363
Score: 0.633
Data Source: STRINGDB
TGFB1
Tchem
Novelty: 0.00014007
Score: 0.617
Data Source: STRINGDB
SIAH1
Tbio
Family: Enzyme
Novelty: 0.01035087
Score: 0.583
Data Source: STRINGDB
ITCH
Tbio
Family: Enzyme
Novelty: 0.00714671
Score: 0.571
Data Source: STRINGDB
RUNX2
Tbio
Family: TF
Novelty: 0.00035641
Score: 0.569
Data Source: STRINGDB
MLXIPL
Tbio
Family: TF
Novelty: 0.00433933
Score: 0.542
Data Source: STRINGDB
ARNTL
Tbio
Family: TF
Novelty: 0.00130179
Score: 0.54
Data Source: STRINGDB
Publication Statistics
PubMed Score  114.88

PubMed score by year
PubTator Score  64.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSD
1-70
LSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKS
70-140
PVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRS
140-210
KCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLP
210-280
ANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGF
280-350
SPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
350-420
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
420-480
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ