Protein Summary
Unknown. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. This gene encodes a tumor antigen recognized by autologous cytolytic lymphocytes (CTL). [provided by RefSeq, Jul 2008]
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
cell type or tissue | 0.93 | ||
tissue | 0.68 | ||
gene perturbation | 0.5 | ||
cellular component | 0.49 | ||
small molecule perturbation | 0.49 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 0 (req: < 5)
Gene RIFs: 3 (req: <= 3)
Antibodies: 0 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 0 (req: >= 5)
Gene RIFs: 3 (req: > 3)
Antibodies: 0 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Term: 0
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Gene Ontology Terms (1)
Components (1)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Electronic Annotation (IEA) | UniProtKB-SubCell | |||
Protein-Protein Interactions (0)
Publication Statistics
PubTator Score 30.86
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF
1-70
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF
Find similar targets by: