You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
BAGE
B melanoma antigen 1

Protein Summary
Description
Unknown. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. This gene encodes a tumor antigen recognized by autologous cytolytic lymphocytes (CTL). [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Symbol
  • BAGE1
  • BAGE1
  • CT2.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.93
tissue
0.68
gene perturbation
0.5
cellular component
0.49
small molecule perturbation
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Publication Statistics
PubTator Score  30.86

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF
1-70
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF