You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDC16
Cell division cycle protein 16 homolog

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252457
  • ENSP00000252457
  • ENSG00000130177
  • ENST00000356221
  • ENSP00000348554
  • ENST00000360383
  • ENSP00000353549
  • ENST00000375308
  • ENSP00000364457
  • ENST00000375310
  • ENSP00000364459

Symbol
  • ANAPC6
  • APC6
  • CUT9
  • ANAPC6
  • CDC16Hs
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.98
biological process
0.94
disease perturbation
0.93
cellular component
0.91
kinase perturbation
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.67   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 382   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.67   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 382   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (70)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 37
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
LIFEdb
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (561)
1 – 10 of 561
ANAPC13
Tbio
Family: Enzyme
Novelty: 0.0994907
p_int: 0.999999852
p_ni: 1.45e-7
p_wrong: 3e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC2
Tbio
Family: Enzyme
Novelty: 0.25398893
p_int: 0.99999971
p_ni: 2.89e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
C16orf87
Tdark
p_int: 0.999999263
p_ni: 7.37e-7
Score: 0.499
Data Source: BioPlex,STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
p_int: 0.999999157
p_ni: 8.43e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC4
Tbio
Family: Enzyme
Novelty: 1.93548387
p_int: 0.999998986
p_ni: 0.000001014
Score: 0.999
Data Source: BioPlex,STRINGDB
KIAA0586
Tbio
Novelty: 0.04074584
p_int: 0.999997849
p_ni: 0.000002145
p_wrong: 5e-9
Data Source: BioPlex
CDC23
Tbio
Novelty: 0.02675154
p_int: 0.999996688
p_ni: 0.000003312
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.999996427
p_ni: 0.000003573
Score: 0.999
Data Source: BioPlex,STRINGDB
CEP295
Tbio
Novelty: 0.32876712
p_int: 0.999990286
p_ni: 0.000009706
p_wrong: 8e-9
Data Source: BioPlex
ANAPC1
Tbio
Family: Enzyme
Novelty: 0.02248926
p_int: 0.999978957
p_ni: 0.000021043
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  64.67

PubMed score by year
PubTator Score  38.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE
1-70
ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY
70-140
DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK
140-210
KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK
210-280
ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH
280-350
DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
350-420
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS
420-490
LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS
490-560
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
560-620
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST