You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IL24
Interleukin-24

Protein Summary
Description
Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294984
  • ENSP00000294984
  • ENSG00000162892
  • ENST00000367093
  • ENSP00000356060
  • ENST00000391929
  • ENSP00000375795
  • ENST00000611909
  • ENSP00000484900

Symbol
  • MDA7
  • ST16
  • C49A
  • FISP
  • MDA7
  • MOB5
  • ST16
  • IL10B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.94
gene perturbation
0.9
biological term
0.85
protein domain
0.73
PubMedID
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 887.21   (req: < 5)
Gene RIFs: 116   (req: <= 3)
Antibodies: 338   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 887.21   (req: >= 5)
Gene RIFs: 116   (req: > 3)
Antibodies: 338   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (161)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-20 family signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-20 family signaling
Signaling by Interleukins
Gene Ontology Terms (13)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (94)
1 – 10 of 94
IL20RA
Tbio
Novelty: 0.03295383
Score: 0.986
Data Source: Reactome,STRINGDB
IL20RB
Tbio
Novelty: 0.02522211
Score: 0.975
Data Source: Reactome,STRINGDB
IL22RA1
Tbio
Novelty: 0.01436658
Score: 0.971
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.945
Data Source: Reactome,STRINGDB
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.936
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.926
Data Source: Reactome,STRINGDB
IL10RB
Tbio
Novelty: 0.01345152
Score: 0.849
Data Source: STRINGDB
IL10RA
Tbio
Novelty: 0.00774907
Score: 0.801
Data Source: STRINGDB
IL22RA2
Tbio
Novelty: 0.04102751
Score: 0.78
Data Source: STRINGDB
IL26
Tbio
Novelty: 0.02226065
Score: 0.738
Data Source: STRINGDB
Publication Statistics
PubMed Score  887.21

PubMed score by year
PubTator Score  260.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLW
1-70
EAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTL
70-140
ANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
140-206
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL