You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TSPAN31
Tetraspanin-31

Protein Summary
Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000257910
  • ENSP00000257910
  • ENSG00000135452

Symbol
  • SAS
  • SAS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.96
disease perturbation
0.95
virus perturbation
0.92
kinase perturbation
0.88
gene perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.77   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 120   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.77   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 120   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (118)
1 – 10 of 118
BCL2L13
Tbio
Novelty: 0.02325978
p_int: 0.999999999
Data Source: BioPlex
NRM
Tbio
Novelty: 0.04643449
p_int: 0.999988868
p_ni: 0.000008754
p_wrong: 0.000002378
Data Source: BioPlex
ALG14
Tbio
Family: Enzyme
Novelty: 0.1802962
p_int: 0.999959376
p_ni: 0.000036202
p_wrong: 0.000004422
Data Source: BioPlex
RETREG2
Tdark
Novelty: 0.375
p_int: 0.999905429
p_ni: 0.000083037
p_wrong: 0.000011534
Data Source: BioPlex
ATP1B2
Tclin
Family: Transporter
Novelty: 0.03783397
p_int: 0.999866125
p_ni: 0.000010171
p_wrong: 0.000123704
Data Source: BioPlex
FXYD6
Tbio
Family: IC
Novelty: 0.05831997
p_int: 0.999511943
p_ni: 0.000408032
p_wrong: 0.000080025
Data Source: BioPlex
ZDHHC7
Tbio
Family: Enzyme
Novelty: 0.08484321
p_int: 0.996900902
p_ni: 1.01e-7
p_wrong: 0.003098997
Data Source: BioPlex
LAPTM4B
Tbio
Novelty: 0.01087209
p_int: 0.996756462
p_ni: 0.000366815
p_wrong: 0.002876723
Data Source: BioPlex
MT-ATP8
Tbio
Family: Enzyme
Novelty: 0.00394859
p_int: 0.996371988
p_ni: 0.003447198
p_wrong: 0.000180814
Data Source: BioPlex
SLC35F2
Tbio
Family: Transporter
Novelty: 0.14326322
p_int: 0.992014913
p_ni: 0.007555804
p_wrong: 0.000429284
Data Source: BioPlex
Publication Statistics
PubMed Score  4.77

PubMed score by year
PubTator Score  77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVGAVNH
1-70
HQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQ
70-140
QDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL
140-210
MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL