You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HYAL2
Hyaluronidase-2

Protein Summary
Description
Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product which is further hydrolyzed by sperm hyaluronidase to give small oligosaccharides. Displays very low levels of activity. Associates with and negatively regulates MST1R. This gene encodes a weak acid-active hyaluronidase. The encoded protein is similar in structure to other more active hyaluronidases. Hyaluronidases degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan and fragments of hyaluronan are thought to be involved in cell proliferation, migration and differentiation. Although it was previously thought to be a lysosomal hyaluronidase that is active at a pH below 4, the encoded protein is likely a GPI-anchored cell surface protein. This hyaluronidase serves as a receptor for the oncogenic virus Jaagsiekte sheep retrovirus. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. This gene encodes tw ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357750
  • ENSP00000350387
  • ENSG00000068001
  • ENST00000395139
  • ENSP00000378571
  • ENST00000442581
  • ENSP00000406657
  • ENST00000447092
  • ENSP00000401853

Symbol
  • LUCA2
  • LUCA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.94
cellular component
0.87
transcription factor binding site profile
0.82
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.19   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 254   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.19   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 254   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 44
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Glycosaminoglycan metabolism (R-HSA-1630316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycosaminoglycan metabolism
Reactome
Hyaluronan metabolism
Reactome
Hyaluronan uptake and degradation
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
Glycosaminoglycan metabolism
Hyaluronan metabolism
Hyaluronan uptake and degradation
Metabolism
Metabolism of carbohydrates
Gene Ontology Terms (60)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (62)
1 – 10 of 62
DPEP1
Tclin
Family: Enzyme
Novelty: 0.0033193
p_int: 0.999008084
p_ni: 0.000991912
p_wrong: 4e-9
Data Source: BioPlex
DPEP2
Tbio
Family: Enzyme
Novelty: 0.17590584
p_int: 0.996608775
p_ni: 0.003296425
p_wrong: 0.000094801
Score: 0.544
Data Source: BioPlex,STRINGDB
TAZ
Tbio
Novelty: 0.00236739
p_int: 0.993953787
p_ni: 0.006046174
p_wrong: 4e-8
Data Source: BioPlex
PON2
Tbio
Family: Enzyme
Novelty: 0.00504516
p_int: 0.990867066
p_ni: 0.009132934
Data Source: BioPlex
SLC39A5
Tbio
Family: Transporter
Novelty: 0.06778122
p_int: 0.989736637
p_ni: 0.006268815
p_wrong: 0.003994548
Data Source: BioPlex
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.975864404
p_ni: 0.023444153
p_wrong: 0.000691443
Data Source: BioPlex
FUT3
Tbio
Family: Enzyme
Novelty: 0.00272149
p_int: 0.958980065
p_ni: 0.008750375
p_wrong: 0.03226956
Score: 0.179
Data Source: BioPlex,STRINGDB
MPPE1
Tbio
Family: Enzyme
Novelty: 0.25531915
p_int: 0.939223255
p_ni: 0.043240438
p_wrong: 0.017536307
Data Source: BioPlex
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.9323135
p_ni: 0.067675101
p_wrong: 0.000011399
Score: 0.155
Data Source: BioPlex,STRINGDB
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.923658539
p_ni: 0.076330991
p_wrong: 0.00001047
Data Source: BioPlex
Publication Statistics
PubMed Score  109.19

PubMed score by year
PubTator Score  74.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGF
1-70
VNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPV
70-140
WVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPD
140-210
CYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVAR
210-280
THHANHALPVYVFTRPTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRL
280-350
LVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
350-420
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
420-473
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL