You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KIF5A
Kinesin heavy chain isoform 5A

Protein Summary
Description
Microtubule-dependent motor required for slow axonal transport of neurofilament proteins (NFH, NFM and NFL). Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. The ZFYVE27-KIF5A complex contributes to the vesicular transport of VAPA, VAPB, SURF4, RAB11A, RAB11B and RTN3 proteins in neurons. Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation. This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000455537
  • ENSP00000408979
  • ENSG00000155980

Symbol
  • NKHC1
  • NKHC
  • ALS25
  • MY050
  • NEIMY
  • SPG10
  • D12S1889
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
virus perturbation
0.85
transcription factor perturbation
0.74
gene perturbation
0.66
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 57.28   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 247   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 57.28   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 247   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
COPI-dependent Golgi-to-ER retrograde traffic
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Golgi-to-ER retrograde transport
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
COPI-dependent Golgi-to-ER retrograde traffic
Factors involved in megakaryocyte development and platelet production
Golgi-to-ER retrograde transport
Hemostasis
Gene Ontology Terms (27)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (326)
1 – 10 of 326
KLC1
Tbio
Novelty: 0.01247284
p_int: 0.999999846
p_ni: 1.53e-7
p_wrong: 1e-9
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
SYNE4
Tdark
Novelty: 0.21538462
p_int: 0.99999927
p_ni: 7.3e-7
p_wrong: 1e-9
Data Source: BioPlex
TRAK2
Tbio
Novelty: 0.07192089
p_int: 0.999997922
p_ni: 0.000002078
Score: 0.875
Data Source: BioPlex,STRINGDB
MYCL
Tbio
Family: TF
Novelty: 0.00183456
p_int: 0.999996918
p_ni: 0.000003082
Data Source: BioPlex
COG6
Tbio
Novelty: 0.02702441
p_int: 0.999989242
p_ni: 0.000010758
Score: 0.552
Data Source: BioPlex,STRINGDB
DTNBP1
Tbio
Novelty: 0.00371788
p_int: 0.999978387
p_ni: 0.000021611
p_wrong: 2e-9
Score: 0.465
Data Source: BioPlex,STRINGDB
TRAK1
Tbio
Novelty: 0.06426328
p_int: 0.999929297
p_ni: 0.000070703
Score: 0.746
Data Source: BioPlex,STRINGDB
NUP62
Tbio
Novelty: 0.01433478
p_int: 0.999834265
p_ni: 0.000165735
Data Source: BioPlex
TRIP6
Tbio
Novelty: 0.03035413
p_int: 0.999777989
p_ni: 0.00022201
p_wrong: 1e-9
Score: 0.214
Data Source: BioPlex,STRINGDB
CEBPG
Tbio
Family: TF
Novelty: 0.1187853
p_int: 0.999660844
p_ni: 0.000339156
Data Source: BioPlex
Publication Statistics
PubMed Score  57.28

PubMed score by year
PubTator Score  62.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQI
1-70
VKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYL
70-140
DKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFL
140-210
INIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYR
210-280
DSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEK
280-350
EKTKAQKETIAKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
350-420
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQA
420-490
LEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMKDLSE
490-560
FSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQ
560-630
LLISQHEAKIRSLTEYMQSVELKKRHLEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALE
630-700
LQMESHREAHHRQLARLRDEINEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLY
700-770
ERHEQSKQDLKGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
770-840
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSG
840-910
KRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGA
910-980
TSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS
980-1032
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDEINEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDLKGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS