You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOXO1
Forkhead box protein O1

Protein Summary
Description
Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress. Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3'. Activity suppressed by insulin. Main regulator of redox balance and osteoblast numbers and controls bone mass. Orchestrates the endocrine function of the skeleton in regulating glucose metabolism. Acts synergistically with ATF4 to suppress osteocalcin/BGLAP activity, increasing glucose levels and triggering glucose intolerance and insulin insensitivity. Also suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP. In hepatocytes, promotes gluconeogenesis by acting together with PPARGC1A and CEBPA to activate the expression of genes such as IGFBP1, G6PC and PCK1. Important regulator of cell death acting downstream of CDK1, PKB/AKT1 and ST ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379561
  • ENSP00000368880
  • ENSG00000150907

Symbol
  • FKHR
  • FOXO1A
  • FKH1
  • FKHR
  • FOXO1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
kinase
1
hub protein
0.99
virus perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1372.65   (req: < 5)
Gene RIFs: 478   (req: <= 3)
Antibodies: 1900   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1372.65   (req: >= 5)
Gene RIFs: 478   (req: > 3)
Antibodies: 1900   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 50
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (98)
AKT phosphorylates targets in the nucleus (R-HSA-198693)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 27
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AKT phosphorylates targets in the nucleus
Reactome
AKT-mediated inactivation of FOXO1A
Reactome
Constitutive Signaling by AKT1 E17K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
AKT phosphorylates targets in the nucleus
AKT-mediated inactivation of FOXO1A
Constitutive Signaling by AKT1 E17K in Cancer
Cytokine Signaling in Immune system
Developmental Biology
Gene Ontology Terms (55)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (405)
1 – 10 of 405
AKT1
Tchem
Family: Kinase
Novelty: 0.0000383
Score: 0.998
Data Source: Reactome,STRINGDB
SIRT1
Tchem
Family: Epigenetic
Novelty: 0.00025951
Score: 0.995
Data Source: Reactome,STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.981
Data Source: Reactome,STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.98
Data Source: STRINGDB
CEBPB
Tbio
Family: TF
Novelty: 0.00076161
Score: 0.98
Data Source: STRINGDB
AKT2
Tchem
Family: Kinase
Novelty: 0.00224767
Score: 0.98
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.979
Data Source: Reactome,STRINGDB
SMAD3
Tbio
Family: TF
Novelty: 0.00058288
Score: 0.978
Data Source: Reactome,STRINGDB
CDKN1B
Tbio
Family: Enzyme
Novelty: 0.00079036
Score: 0.974
Data Source: STRINGDB
CDK2
Tchem
Family: Kinase
Novelty: 0.00033882
Score: 0.973
Data Source: STRINGDB
Publication Statistics
PubMed Score  1372.65

PubMed score by year
PubTator Score  959.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADF
1-70
MSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPA
70-140
AAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK
140-210
NSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSG
210-280
QEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP
280-350
SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
350-420
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSR
420-490
VLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKT
490-560
PVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDF
560-630
NFDNVLPNQSFPHSVKTTTHSWVSG
630-655
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG