You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ADIG
Adipogenin

Protein Summary
Description
Plays a role in stimulating adipocyte differentiation and development. ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation (Kim et al., 2005 [PubMed 15567149]; Hong et al., 2005 [PubMed 16132694]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000470147
  • ENSP00000434385
  • ENSG00000182035
  • ENST00000537425
  • ENSP00000440331

Symbol
  • SMAF1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.53
tissue sample
0.5
small molecule perturbation
0.43
cell line
0.4
tissue
0.36


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.26   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 11   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.26   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 11   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
HGNC
Inferred from Sequence or structural Similarity (ISS)
HGNC
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (9)
1 – 9 of 9
PPARG
Tclin
Family: NR
Novelty: 0.00012454
Score: 0.54
Data Source: STRINGDB
VTI1B
Tbio
Novelty: 0.01384977
Score: 0.513
Data Source: STRINGDB
FABP4
Tchem
Novelty: 0.00130496
Score: 0.488
Data Source: STRINGDB
FCAMR
Tbio
Novelty: 0.08272059
Score: 0.467
Data Source: STRINGDB
POU6F2
Tbio
Family: TF
Novelty: 0.03084244
Score: 0.449
Data Source: STRINGDB
ADIPOQ
Tbio
Novelty: 0.00013138
Score: 0.448
Data Source: STRINGDB
ACAD11
Tbio
Family: Enzyme
Novelty: 0.55263158
Score: 0.438
Data Source: STRINGDB
SPEM1
Tdark
Novelty: 0.32520325
Score: 0.43
Data Source: STRINGDB
G6PC2
Tbio
Family: Enzyme
Novelty: 0.01563173
Score: 0.418
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.26

PubMed score by year
PubTator Score  2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTL
1-70
HGQEKERPCW
70-80
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCW