Protein Summary
Plays a role in stimulating adipocyte differentiation and development. ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation (Kim et al., 2005 [PubMed 15567149]; Hong et al., 2005 [PubMed 16132694]).[supplied by OMIM, Mar 2008]
- ENST00000470147
- ENSP00000434385
- ENSG00000182035
- ENST00000537425
- ENSP00000440331
- SMAF1
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
cellular component | 0.53 | ||
tissue sample | 0.5 | ||
small molecule perturbation | 0.43 | ||
cell line | 0.4 | ||
tissue | 0.36 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 18.26 (req: < 5)
Gene RIFs: 1 (req: <= 3)
Antibodies: 11 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 18.26 (req: >= 5)
Gene RIFs: 1 (req: > 3)
Antibodies: 11 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 4
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Gene Ontology Terms (8)
Components (4)
Processes (4)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Sequence or structural Similarity (ISS) | HGNC | |||
Inferred from Sequence or structural Similarity (ISS) | HGNC | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (9)
1 – 9 of 9
PPARG
Family: NR
Novelty: 0.00012454
Score: 0.54
Data Source: STRINGDB
VTI1B
Novelty: 0.01384977
Score: 0.513
Data Source: STRINGDB
FABP4
Novelty: 0.00130496
Score: 0.488
Data Source: STRINGDB
FCAMR
Novelty: 0.08272059
Score: 0.467
Data Source: STRINGDB
POU6F2
Family: TF
Novelty: 0.03084244
Score: 0.449
Data Source: STRINGDB
ADIPOQ
Novelty: 0.00013138
Score: 0.448
Data Source: STRINGDB
ACAD11
Family: Enzyme
Novelty: 0.55263158
Score: 0.438
Data Source: STRINGDB
SPEM1
Novelty: 0.32520325
Score: 0.43
Data Source: STRINGDB
G6PC2
Family: Enzyme
Novelty: 0.01563173
Score: 0.418
Data Source: STRINGDB
Publication Statistics
PubMed Score 18.26
PubMed score by year
PubTator Score 2
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTL
1-70
HGQEKERPCW
70-80
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCW
Find similar targets by: